Entry information : Ha2CysPrx03 ((HanXRQChr13g0398251))
Entry ID 13666
Creation 2016-05-11 (Christophe Dunand)
Last sequence changes 2018-01-04 (Bruno Savelli)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2018-01-04 (Bruno Savelli)
Peroxidase information: Ha2CysPrx03 ((HanXRQChr13g0398251))
Name (synonym) Ha2CysPrx03 ((HanXRQChr13g0398251))
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ha2CysPrx03
start..stop
S start..stop
Ha2CysPrx01 446 4e-161 15..256 14..260
Ha2CysPrx02 438 4e-158 20..256 29..265
Nt2CysPrx01-1A 409 3e-146 8..256 17..271
Nt2CysPrx02-1A 404 1e-144 1..256 1..267
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 78735689..78735868 180 N° 2 78736949..78737020 72 N° 3 78737198..78737279 82 N° 4 78737431..78737510 80
N° 5 78737650..78737775 126 N° 6 78737864..78737977 114 N° 7 78738615..78738728 114  
join(78735689..78735868,78736949..78737020,78737198..78737279,78737431..78737510 ,78737650..78737775,78737864..78737977,78738615..78738728)


exon

Literature and cross-references Ha2CysPrx03 ((HanXRQChr13g0398251))
DNA ref. HanXRQ genome:   HanXRQChr13 (78735689..78738728)
Protein sequence: Ha2CysPrx03 ((HanXRQChr13g0398251))
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   256
PWM (Da):   %s   27941.39  
PI (pH):   %s   5.77
Sequence 297
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASSASAALISSPNPFISPKSHTLSFSASSSLTFQSKSLRSSLSLRPSTARRNTFVVKAALPLVGNQAPDFEAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYAEFEKINTEILGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKAFNVLIEDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETLRTLQALQFVQENPDEVCPAGWKPGEKSMKPDPKGSKEYFAAI

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTGCTTCATCTGCCTCTGCAGCTCTTATCTCCTCCCCAAACCCTTTCATTTCCCCCAAATCTCATACCCTAAGCTTCTCCGCCTCCTCCTCCTTGACCTTTCAGTCCAAATCCCTCC
GTTCTTCCCTCTCTCTCCGCCCCTCCACCGCCCGCCGCAACACATTCGTCGTCAAAGCT
GTAAGTACTCCCTTCCCTTCCCCTATATATAACGCTTTCGCTTTTCAACCGAATTTAACCC
GACTGACAATTTGTCGAACTGAAAACCGATTATTAGGTTATTATTCACTTTCGGTTCCGGTTTAAAACAATTGTTTAAAACGACACCGTTTTGCATATCAACAGTATCCTAATAGTTAAG
CTTAAACCAGCCTTTTCTGATCACATACTGATTAATTAGAGCAATGCTGCCACGCTATGCAGTTTAGGTTATCTCAGTGGGATATCGATAATTTTAATATCTTGCAGAATTCATTATATC
TGTCAAATATCGGTGATATACTGGTTATATCGGTCAATATCGTCGATAATATCAGTACTGATATTCTGACCGATATTTTACTAGGGGACCGATATAACTTATATCACCGAATGCGGGATA
TAGGTAAGGATGCGTGCATTAAGCCCAAGTGGCCTGACATCCTTGGACCCCACGATGGCACGAATGCGGGAGCCTTGTGCAACTGGTTGGCCCCTAAAAGTATTGATTAGTAATTGGTTA
AATACTTGGTTTTAAAAGCTGTGTGCATGAAGGTGTGGGGCCCTCAGGAAATGCTTCAGGGCTTGAGGCAGCGCCTCTTGTACTTCTGGTTGTAAATAAAGCTTATTTGGTTGTACATAG
AGGAATGCATCACATAGGTGATGTGTGCGCCTCAATCCTCAGATTTTGTGACCTAAACGCCTTAGAGCGCCTCTCACCTTTTTAAACCAGGATTAGGGAAGAATATGTAGCCTTTTTGGA
TCCGAAAAAGATGTATGATTTACCTTGATACATTCTGCAATAAATCTTTTATAAAATGAGTCTTAGAATGCCAAAGTGTATACAAAATCAAGCGCCTCTAGTGAAATTATATGTTTTTTA
ATCCTTAACATAGCTCATTATATGGTAAAAATCAGCATATTTTATTACGGAAATTTGAGCCAGGGGACTGAGTAATGTTGATCATTAATCATCTAATACATAATGTGTTCTTTTTTGTCT
TAGTTTTAATAATTTATGTTAGCTATCTATCACTCATGTTGACATCTTTTTATCTGTAGGCACTGCCACTAGTTGGAAATCAGGCACCGGACTTTGAAGCTGAGGCTGTTTTTGATCAAG
AGTTCATTAAT
GTAAGTGAAGTGACTTTCGATGTTTGCTTTTGAAACTTTATATTGTTTGCAGGAGCGTTATGGACCGTTGCTCCGTTATTTTTTTTAAGTTAACAAGTCTAGTTTTTCT
TGTTACATACTCGGTATTTCTTAAGAAATTGAAAATTTTGTAACTTTGTAAAAAAAATGTCATCGCAGGTTAAGCTCTCTGACTACATTGGCAAGAAATATGTCATTCTCTTTTTCTACC
CTTTGGACTTCACTTTTGTTTGTCCAACAG
GTGAGTAGCCCGTTGCTTGTTAAACGCAAAAACCTTTTATTTTTAGCTATCTTCATATTTACTGAAATATGGATACAGTTTATAGATACG
TGTAACGATGGCTGTTATATTTTTTCCTTCAACTTCTACTAATTTTGTTTTCTTATTATAGAAATCACTGCATTCAGTGACCGATATGCAGAATTCGAGAAGATTAATACTGAAATATTG
GGCGTTTCTGTAGACAGTGTG
GTAATTGTTTCTTACATCATTATACAACATTATGATATTTAACGCTTTTTTTTTTTTTTTTTTTTTTTTTTTGCATAAGTATGTCGTTTAAAAGGCGAC
CAAAATGTGAAATATGTGTATGGTGTTTTGTTTTCGACAGTTCTCCCACCTTGCATGGGTTCAAACAGACAGAAAATCTGGCGGTCTTGGTGATCTGAACTACCCTCTGATTTCCGATGT
CACAAAATCGATTTCAAAAGCTTTCAATGTGTTGATTGAAGACCAG
GTACACATTTATAAATAATTTTTCGATAACTTTTTAGCCATTTGTATATAATTATTTCCTATGTCAAAATATCG
GTTTTCAATTTCAGGGAATAGCATTGAGAGGGCTTTTCATAATTGATAAGGAAGGTGTCATCCAACACTCCACAATTAACAATCTCGCAATTGGTCGAAGCGTTGATGAAACATTGAGAA
CACTTCAG
GTAAACATGCAGCATGAGTGGGCTAGGTAACGGGTCCAAGTGAGTTTTGTACTTGTGCGGGTTGGGTTGGGTTGACTTAGAAACATTTTTGTTCTTTTATTTTTATGAGTAA
AGAACACGGATTGTCTTTGTGGTTTACCAAAATATTGGATTTGGTCCCCAACTTTCCAAAAGTACACGGATGGTCCCTCATGGTTTGCACTTTGTAACGCATTTAGTCCCCAACCAACAA
ATCTAAAGGTTTTAGCACGTCCTGGTTAGGGACTAAATGCGTTACAAAGTGCGAACCACAGGGACCATCCATGTACTTTTGGAAGAAGATGGGGACTAAATGCGTTACAAAGTGCAAACC
ACAGGGGCCGTCTGTCTACTTTTGGAAAGCTAGGGACCAAATCCATAATTTACTCATTTTTATTTTATTTTTAAATAATTGGCATGCCAAATAAAATAAATCGTTTTGTTAGCCTTTTAG
CATTGAAAATACACTTTGGCGATTTTGACGAGTCATACTTGTTTTCTTGATATTACATTATTACCCGTTTGGCCCGTTAGAGATAAAACTATAAAAGTAACAAAATCTGCTCGTTCTTGG
TATGTTGAGCTCATTGGTAATTGCATTTCTGTGTTTGTATCGTAGGCATTGCAATTTGTACAAGAGAACCCGGATGAGGTATGCCCGGCTGGATGGAAGCCAGGGGAGAAGTCGATGAAG
CCCGACCCTAAGGGCAGCAAGGAATACTTTGCGGCCATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTGCTTCATCTGCCTCTGCAGCTCTTATCTCCTCCCCAAACCCTTTCATTTCCCCCAAATCTCATACCCTAAGCTTCTCCGCCTCCTCCTCCTTGACCTTTCAGTCCAAATCCCTCC
GTTCTTCCCTCTCTCTCCGCCCCTCCACCGCCCGCCGCAACACATTCGTCGTCAAAGCT
GCACTGCCACTAGTTGGAAATCAGGCACCGGACTTTGAAGCTGAGGCTGTTTTTGATCAAG
AGTTCATTAAT
GTTAAGCTCTCTGACTACATTGGCAAGAAATATGTCATTCTCTTTTTCTACCCTTTGGACTTCACTTTTGTTTGTCCAACAGAAATCACTGCATTCAGTGACCGATATG
CAGAATTCGAGAAGATTAATACTGAAATATTGGGCGTTTCTGTAGACAGTGTG
TTCTCCCACCTTGCATGGGTTCAAACAGACAGAAAATCTGGCGGTCTTGGTGATCTGAACTACCCTC
TGATTTCCGATGTCACAAAATCGATTTCAAAAGCTTTCAATGTGTTGATTGAAGACCAG
GGAATAGCATTGAGAGGGCTTTTCATAATTGATAAGGAAGGTGTCATCCAACACTCCACAA
TTAACAATCTCGCAATTGGTCGAAGCGTTGATGAAACATTGAGAACACTTCAG
GCATTGCAATTTGTACAAGAGAACCCGGATGAGGTATGCCCGGCTGGATGGAAGCCAGGGGAGAAGT
CGATGAAGCCCGACCCTAAGGGCAGCAAGGAATACTTTGCGGCCATA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTT CATCTGCCTC TGCAGCTCTT ATCTCCTCCC CAAACCCTTT CATTTCCCCC AAATCTCATA CCCTAAGCTT CTCCGCCTCC TCCTCCTTGA CCTTTCAGTC CAAATCCCTC  CGTTCTTCCC TCTCTCTCCG CCCCTCCACC GCCCGCCGCA ACACATTCGT CGTCAAAGCT GCACTGCCAC TAGTTGGAAA TCAGGCACCG GACTTTGAAG CTGAGGCTGT TTTTGATCAA  GAGTTCATTA ATGTTAAGCT CTCTGACTAC ATTGGCAAGA AATATGTCAT TCTCTTTTTC TACCCTTTGG ACTTCACTTT TGTTTGTCCA ACAGAAATCA CTGCATTCAG TGACCGATAT  GCAGAATTCG AGAAGATTAA TACTGAAATA TTGGGCGTTT CTGTAGACAG TGTGTTCTCC CACCTTGCAT GGGTTCAAAC AGACAGAAAA TCTGGCGGTC TTGGTGATCT GAACTACCCT  CTGATTTCCG ATGTCACAAA ATCGATTTCA AAAGCTTTCA ATGTGTTGAT TGAAGACCAG GGAATAGCAT TGAGAGGGCT TTTCATAATT GATAAGGAAG GTGTCATCCA ACACTCCACA  ATTAACAATC TCGCAATTGG TCGAAGCGTT GATGAAACAT TGAGAACACT TCAGGCATTG CAATTTGTAC AAGAGAACCC GGATGAGGTA TGCCCGGCTG GATGGAAGCC AGGGGAGAAG  TCGATGAAGC CCGACCCTAA GGGCAGCAAG GAATACTTTG CGGCCATATA GTTAGACGCC TTTCCTTTTA TTTTCATTGA ACTGAATTGA GTTTTGGGTA AAACCCTCAA GTCTGGACTA  CATTTCTTGA AACAGTGTTG TAAGCATGTT AAAGCTCAAA ACGTCTAATG AGTATTTGTA TTTTGATTAT AACGACGGAG TATGAGTTAA GTATGTATGT TATAGCTTAC TTAATTTTTA  CCGAGAAGAA TACGTTAGTG ACTTTGTATG AAGGTATGAA GATGAGGTTT GTAAGAGCAT CTGCAGTTGA TGCAATGGGT GACAAAATCC GATTAGTTGA CTTAAAACCG AATTAACCGA 
TAAAAC 

Retrieve as FASTA