Entry information : HaTrxF01 (HanXRQChr17g0556061)
Entry ID 13667
Creation 2016-05-11 (Christophe Dunand)
Last sequence changes 2017-11-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaTrxF01 (HanXRQChr17g0556061)
Name (synonym) HaTrxF01 (HanXRQChr17g0556061)
Class Thioredoxin Type F    [Orthogroup: TrxF001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaTrxF01
start..stop
S start..stop
HaTrxH03 207 2e-68 1..174 63..245
AtTrxF01 199 4e-66 16..174 16..175
AtTrxF02 199 4e-66 56..174 66..185
ThasTrxF01 192 1e-63 44..174 50..180
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 107428369..107428658 290 N° 2 107427104..107427203 100 N° 3 107426169..107426300 132  
complement(join(107426169..107426300,107427104..107427203,107428369..107428658))


exon

Literature and cross-references HaTrxF01 (HanXRQChr17g0556061)
DNA ref. HanXRQ genome:   HanXRQChr17 (107428658..107426169)
EST ref. GenBank:   GE517490.1
Protein sequence: HaTrxF01 (HanXRQChr17g0556061)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   174
PWM (Da):   %s   19015.15  
PI (pH):   %s   9.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVQIHQLCRPVPPPPSTTAIGSLPSCFTKQSTVSGDRYPFKSVNKKKGLRSLVTVRSSLETAVVVGQVTEVSQDTFWPIVNAAGDKTVVLDMYTQWCGPCKVIAPKFKELSEKYLDVVFLKLDCNQDNALAKELGIKVVPTFKILKDSKIVKEVTGAKFDNLVVAIEEVRSS

Retrieve as FASTA  
Remarks Complete sequence from genomic and EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGTACAGATTCATCAACTCTGCCGGCCGGTACCACCACCACCGTCTACGACGGCGATCGGCTCACTGCCGTCATGCTTTACAAAGCAGTCTACAGTTTCCGGAGACCGTTACCCG
TTTAAATCTGTGAATAAGAAGAAAGGACTGAGGTCATTGGTGACGGTTAGGTCAAGTTTGGAAACCGCGGTGGTTGTCGGTCAGGTGACGGAGGTTAGTCAGGATACGTTTTGGCCGATT
GTGAATGCAGCCGGTGATAAGACTGTTGTTCTCGATATGTACACTCAGTG
GTAAGTCCAATTTTGAGTAGAATTGTTTAGTTTTTGAAGATGTGATATGGTTATATAGATTGAATATATA
CCTGATTTGTGTCTACAGAATTCAGGCAGTTTTTGTTTCGGAAATTTGTTAGGTTTTTAAATTGTAGCGGACGGATTAGGCTCAGAAATTGGTTCAACTCGGTTGTACCGGCAACTGACT
AATAAACACTACAATCCATAAAATACAATTTTTACTCAAAAAGTAATCCAAAATTACATCATTTCATAATAAAAATATTCCAAAAGTTAATCCATAATAAAAAAATAATCCAAAAATTCA
CTATTGGTACTTTTTTTTATGCAGAGTAAGTCATCATCGTTTTGGGCCATTAAAACTCTAAATTTTAACATTTGACCCGGCACTGGTATACCGGTATAACCCAATTTACCGGTGGTATAA
CATCTTTGCCGTTCCCTCAATTTACCGGTGTGATTCGTGCCGGCCAAACTTCCAACATCCGGTTTAACCGGCTCCGGCCGGTATAAACCGGTTTTTAAAACATTGAGTGCAACAGATTTT
GATTAATTAAACTTACTCAAAATTTGCAAATAGGGCAACTCCATCGAAAGTTGCAGATACATGTTTTGTTTATTCATTTTCGTGCAAACTCGAAAAAGTAGGTCTTATACTCATGCTAGT
TGATTTGCCTGCTAATTTCTCGAGAATATCCTCCATCACAGCAGAGTTCTCAACGTCAACAAAATTTCATATAGTTCGCCTCCAATGTCAATTCTTGGATGTATATATACCCACAAACAG
AACAGAAGTAGCATATCTCTATCCAGAACAAATAAATTGTATTTCATCGTTTGCAAAAAATGCATAAATACTATGTCATACTTGTCACACATTTTTCTTTAGTTACATACTTGAACACAC
AATGTTTTTAGTCTATACTTTCCTAGGAACGTTAGTTACGTATATTGACAATCAATCATTCTTTTGTGCTAGTAATCTTAACTAAAATCGGACAAAGTAATGGGAATTAATATGATAATG
AGTATCACAAATATGTATATCTGTTACTCACATGTTTAAGAATTAAGATTACTACTTAGCTAGTTAGCTGTATTCTTTTCTTATATTGCCTCTTTCCCTAGTCATGTGGTGTTGATTGTC
CGATAAACTTGATAGGTGCGGTCCTTGCAAGGTCATTGCTCCAAAATTCAAAGAATTGTCTGAGAAGTATCTTGATGTGGTCTTTCTAAAGCTTGATTGCAATCAGGACAACAAGGTTCG
TTCTTAACTTTCTTTAATTCCTTTAAAGCATCATCTTTCCCCAACACCACACACCCATATTTGAAAACTCGACAAACACAGGGGTTGTAGAGATCGATTAATACTGAAGGTGCCAAAAAA
GAGTCATATGGGTTAAGGTAAAAGTTTTAGCTAAAAAAGAAACGGGTCGCAAGTCATTCAATATGTATTTAAATGTAGAAGAAACACTCAAATAGTTTCTGTAGACATGCTTCACACATT
CAAGTATACATAAAATCCATTAGTAGTTAGCTAAAAAAATTGTGTACACCCGTTTTGACCCATGGTAAAATACCCACATTGTTCACTTGATGAAACTTAGTGGTGGCGATTTTTGACACG
ACCGTGGAAACACGACACGGAAGCAATCAGGTTTTGGTTTCTTATATCTTACCAGTTTAATAAATAGGTCATGTGGGTTTACTTGTTTAGCCCATATAATAGTATATAATTCCACACGAA
AAAGGGCAATTACAAAGCAATGGCAGGTAGTCGGGCAACAAGTTGCGCCGCCACCCCCTTTAGTCAAACAGGTCAACTCGTCAACCTATTTAATTAAACAGGTAAACCCCTTTTTTACAA
TCCAACAACCCAGTTAGCACATTTACATCTTAATTTCTACCTGGCAACCCATTATACACTTTTAGATAACTGTATTAAACAGGGCGTGTAGTGTGAGGGTTAGTGTTGATGTTTTTGCCA
CAAATATAAGGGTCGTGCGAGGGCTGTACAAGTCTACCCGCCAACCTGACACGATTCACACTTTAATAAAACTGACAGGCATTAGCAAAGGAGCTAGGAATAAAGGTGGTCCCTACCTTC
AAGATACTGAAAGACAGTAAGATTGTAAAAGAAGTTACAGGGGCTAAGTTTGATAATTTAGTTGTGGCAATAGAGGAGGTTAGATCTTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGTACAGATTCATCAACTCTGCCGGCCGGTACCACCACCACCGTCTACGACGGCGATCGGCTCACTGCCGTCATGCTTTACAAAGCAGTCTACAGTTTCCGGAGACCGTTACCCG
TTTAAATCTGTGAATAAGAAGAAAGGACTGAGGTCATTGGTGACGGTTAGGTCAAGTTTGGAAACCGCGGTGGTTGTCGGTCAGGTGACGGAGGTTAGTCAGGATACGTTTTGGCCGATT
GTGAATGCAGCCGGTGATAAGACTGTTGTTCTCGATATGTACACTCAGTG
GTGCGGTCCTTGCAAGGTCATTGCTCCAAAATTCAAAGAATTGTCTGAGAAGTATCTTGATGTGGTCTTT
CTAAAGCTTGATTGCAATCAGGACAACAAG
GCATTAGCAAAGGAGCTAGGAATAAAGGTGGTCCCTACCTTCAAGATACTGAAAGACAGTAAGATTGTAAAAGAAGTTACAGGGGCTAAG
TTTGATAATTTAGTTGTGGCAATAGAGGAGGTTAGATCTTCT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCCTCGTCTC TCTCACCCAC ACTATACATA CACACTGTGT CTCAATGGCC GTACAGATTC ATCAACTCTG CCGGCCGGTA CCACCACCAC CGTCTACGAC GGCGATCGGC TCACTGCCGT  CATGCTTTAC AAAGCAGTCT ACAGTTTCCG GAGACCGTTA CCCGTTTAAA TCTGTGAATA AGAAGAAAGG ACTGAGGTCA TTGGTGACGG TTAGGTCAAG TTTGGAAACC GCGGTGGTTG  TCGGTCAGGT GACGGAGGTT AGTCAGGATA CGTTTTGGCC GATTGTGAAT GCAGCCGGTG ATAAGACTGT TGTTCTCGAT ATGTACACTC AGTGGTGCGG TCCTTGCAAG GTCATTGCTC  CAAAATTCAA AGAATTGTCT GAGAAGTATC TTGATGTGGT CTTTCTAAAG CTTGATTGCA ATCAGGACAA CAAGGCATTA GCAAAGGAGC TAGGAATAAA GGTGGTCCCT ACCTTCAAGA  TACTGAAAGA CAGTAAGATT GTAAAAGAAG TTACAGGGGC TAAGTTTGAT AATTTAGTTG TGGCAATAGA GGAGGTTAGA TCTTCTTGAA GTATACATCT TTGTGTATAA TATTAAATAA  ATAATATATA TTTATCTGGC TGTTATTCCA CTTTGATTTC ATTAGAGTTT GTATCCTCTT CTAGAAATAT AAGTATTGTT GTTAGGCCTG TAAATGAACA TTCCGCATTT TTGTGAGCGG  AATGTTTGTT TATGTTCGTT TATTTAAAAA CGACAAACAT GTAAAAAAAT TATTGTTCTC TTAATTAAAC AACTGTGTTA CGTGTCAAAT AATACCAAAC AGGGTATGAA TACATCTCCC 
CTTTGTTGGT CCTCATTCGG GTCGAGTCAT AGCGAGGTTT GAACTAGATT TTAAAAAACA GCAAAACAAG CTATACGAGT ATTGAAC 

Retrieve as FASTA