Entry information : HaGPx01 (HanXRQChr03g0082611)
Entry ID 13675
Creation 2016-05-11 (Christophe Dunand)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGPx01 (HanXRQChr03g0082611)
Name (synonym) HaGPx01 (HanXRQChr03g0082611)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGPx01
start..stop
S start..stop
LuGPx211 345 1.19e-121 2..242 3..241
McGPx01 337 1.6e-118 4..242 1..241
VvGPx01 325 6.45e-114 1..242 1..246
CsGPx01 324 1.86e-113 3..242 5..245
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13675' 'complement(join(134303774..134303800,134304675..134304842,134305013..134305131,134305347..134305408,134305878..134305954,134306794..134307066))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 134306794..134307066 271 N° 2 134305878..134305954 75 N° 3 134305347..134305408 60 N° 4 134305013..134305131 117
N° 5 134304675..134304842 166 N° 6 134303774..134303800 25  
complement(join(134303774..134303800,134304675..134304842,134305013..134305131,1 34305347..134305408,134305878..134305954,134306794..134307066))


exon

Literature and cross-references HaGPx01 (HanXRQChr03g0082611)
DNA ref. HanXRQ genome:   HanXRQChr03 (134307066..134303774)
Cluster/Prediction ref. HanXRQ:   HanXRQChr03g0082611
Protein sequence: HaGPx01 (HanXRQChr03g0082611)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   242
PWM (Da):   %s   26571.39  
PI (pH):   %s   8.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASMPCSLNFTSPFFNFSKSNRTQFPSCLSVSCFGTSSVQSLLGSSSSGLFQHGFALKAGIFSGFSSDSRSEFGVFATAATGKTIYDFTVKDIDRKDVPLSKFKGKVLLIVNVASQCGLT
SSNYSELTQIYNKYKD
GLEILAFPCNQFGFQEPGSNDQIKNFACTRFKAEFPIFDIDVNGPFTAPIYQFLKSNSGGFLGDLVKWNFEKFLVDKNGKVVERYPPTTSPLQIEKDVKKLLAA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTATGCCTTGCTCTTTAAACTTCACTTCCCCATTTTTCAATTTCTCTAAATCCAACCGAACCCAGTTCCCTTCTTGTCTCTCTGTTTCTTGCTTTGGAACTAGTTCTGTCCAA
TCTCTTTTAGGCTCATCAAGTTCAGGGCTTTTCCAACATGGGTTTGCTCTTAAAGCTGGAATCTTTTCTGGGTTTTCGTCTGATTCTCGTTCTGAATTTGGGGTTTTTGCTACAGCTGCC
ACTGGAAAGACTATTTATGATTTTACTGTAAAG
GTAGTGTATATTTCAGCCTCTGTGTTCTTTCATGTCTGCTTTATTGTTTAAATATGTTTTCTTTTGTTTGTGAATTGCACATGTTGA
TGTGGATTTCTTGAGAAGTTTGCAAGATTTATCTTATGAACATAATTGCATTTGTTTGATTGAGCCCATTTTCATCAATTTCCCAACTTAAATTTTGGGAATTCTCTAGAAGCCTGCAAC
TATTTCCATTTTAGGGGGTTTGTTAATTTAGAGTTATCTTGAAGTTTATTTGGTTCCACAAGATGTTTTTTTTTTTCAAAGATTTTATGGGCAATGTTATATTATAATGCAAGATATGTT
AGAAATTTCTGGTTGTACTCGTGATGTGTACGCGTGGAGGCGGCTAGATGAAGAGATCAACTTGTGTTTTGGAGTTGATAAGTTAAACAACATTAATTAGTGGATGATTGTCTAGTATCA
TATACGTGTTAGGATGTGTGTTAGATAATTGTTATGTAATAATAAATTAATAATTAACTCAAAATTCTAGTTATAATCTAACGCGTTAGGTTAGCTACATATACGATGTTTAGTGGTAGG
GATTTGTTATCAAGTTTTTGAGTAGCTTTCTTGATCTGATAATATTGTGGGAGTTAGTCATAATTCTACGTTCGTTCGAATTTCGACTGGGACTTGAAGATACACGTGTTTCAAATTCTG
ATCATATATGATTATGCCCTCTAGGTTACTTTGTAGTCTTTTTGCAGTGATTGTAGAGTATACAACTCTTGTTTGACAAGATGAAAGAAGTTTCATCTATAATTCATTGTTTGTTTTTTT
TTTTTTTTTTTGATGTTTGTTATTAACTGCAGGAGATATCGATCGAAAGGATGTTCCTCTTTCCAAATTCAAGGGAAAGGTTCTACTTATCGTCAATGTTGCATCGCAATGGTAGTTTCT
ACTTATAATATTGAGTTAAATGCCATTTTAGTCCCTGTGGTTTGGGCCATTTTGCCAGTTTAGTCCAAAGGTTTTATTTTTCGCCAATGGGTCCAAAAAGGTTTCACCGTTGCCATTTTA
GTCCACTGGGTTAATTTCATCCATTTTTCTGTTAACGAGAAGGGCAATTTAGTCATTTTATATGTAATTCTGCTAACTAGAAGGGCAATTCGGCCATATAAAATGACCGAATTGCCCTTC
TCGTTAACAGAAAAAATGGATGAAGTTAACCCAGTAGACTAAAATGGCAACGGTGAAACCTTTTTGGACCCACAGGCGAAAAATAAAATCTTTGGACTAAACTGGCAAAATGGCCCAAAC
CACAGGGACTAAAATGGCATTTAACTCTATAATATTTATTAAACTAAATGCAGTAAAGATGAGTGATGCCTCGTTAACTTAAAGTTAACCTTTGTTTCAGTGTGGTTTGACTTCATCTAA
CTACTCCGAGCTCACTCAAATATATAACAAGTACAAAGATCAAG
GTTAGTGGCTATGAAATCCGATGCTATCGTATCAGTTCTTCAACAGTTAGTTGAATAAAACATGATCAGAAACAGA
AGTTAACTGGTTTTCAAATTTTATTAATAAAGTTTACTTGGAATTCGATTGGCATCGGTGCCAACATAATGCAGCATTAGCAAATATTATAAATGCGTACTATGGCTTGATAGTTTAACT
TGTTAATCTTCACATGCAGGAGACTTGAAATATTGGCATTCCCTTGCAATCAGTTCGGGTTCCAAGAACCCGGGTCAAATGATCAGATTAAAAATTTTGCTTGTACAAGGTTCAAAGCCG
AATTCCCGATCTTTGACAAG
GTTGTTTGAGGTTTTCTCTACTTATTCTCGTGTATGATTTGGTACAAAGTTAGAAAGGCGCATTAGCCCTATTACTGAAAGTTACGACCAAAATTTTAAT
TTAATTTTCTGTTCCATTTTGGAGTAAGCCGATTAATAAAAAAGACTAATCAATATCGTATACGCCTCAGATATTGATGTGAATGGCCCGTTTACTGCCCCGATTTATCAATTTCTCAAG
TCGAACAGCGGAGGGTTCTTGGGCGATTTGGTGAAGTGGAATTTTGAGAAGTTTTTAGTAGATAAAAATGGGAAAGTCGTTGAAAGATATCCTCCTACTACTTCCCCTCTTCAGATCGAG
GTACGTACACAATATTCTCCGTAATGAGTTGCAAACTTTTGAACCATTCTTCTAGTTCTTGATAAAATGGAGAAAGTGACACTACACTTTGCAAAAATGAATAAGTTTAAATAAAGAATT
TCCAAGCAGATATCCTTTTTACATTTTGTCTAGTGGCATTGTTTAAAAAAATGTTAGGCATGCGCCTCGAGGCGAGGCAGTAAGAAAACGTGTATGAGGCGCGCCTCATGGGGTTCTGTT
TGTACGTACGCCTATAAGGGCCGAGGTGGTAAGAAAACGTGCGCCTCATGGGGTTATGTGTTTTTGAGGTTTTAGATTTTCTGTGTCAATTATTTTATTTTAGATGTTTTAGACTTACTG
TGTCAATTATTTTATTTTTTTATAAGATATATAATTTTTATATTTATATTTTAATTCTGCCTCGGGCTTACGCCTCGGTTCCCTTGAGGCTTACGCCTCGTGAGGCGAAGGGAAAACACC
TCGAAGCTCGATTTCGTTATTTTAAACCTTGCCTAGAGGTGGCAAAATGGACGGGTTGTTATAAGGTCAAATGGGTAATTTCGGTCGGTAGAAATGGGGTCAATCGGGTTTGCCTGGAAC
ACTATATGTATTTGAAAACAATCACTGTATGAGATACGCTTACAAGGATTACATTATTTCTAACATAATATAAAATTTAAATAGAAAGATTCAAGTGATTTTATGCTTTAAAAATTTAAT
ATTACACCTAGAGTAATTTATTTTCAACTCGTCCCCTTCTTTTGCAAATTCTTGTTTTAGTTTTACTCGTTTGACCCGTTAGAGACAAGAGATATGATTGGATCAACCCATTTATCTCAA
TTCTAACCAAATTAACTGTTGCTGTGTGTTGCAGAAAAGGACGTAAAGAAACTTCTTGCTGCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTATGCCTTGCTCTTTAAACTTCACTTCCCCATTTTTCAATTTCTCTAAATCCAACCGAACCCAGTTCCCTTCTTGTCTCTCTGTTTCTTGCTTTGGAACTAGTTCTGTCCAA
TCTCTTTTAGGCTCATCAAGTTCAGGGCTTTTCCAACATGGGTTTGCTCTTAAAGCTGGAATCTTTTCTGGGTTTTCGTCTGATTCTCGTTCTGAATTTGGGGTTTTTGCTACAGCTGCC
ACTGGAAAGACTATTTATGATTTTACTGTAAAG
GATATCGATCGAAAGGATGTTCCTCTTTCCAAATTCAAGGGAAAGGTTCTACTTATCGTCAATGTTGCATCGCAATGTGGTTTGACT
TCATCTAACTACTCCGAGCTCACTCAAATATATAACAAGTACAAAGATCAAG
GACTTGAAATATTGGCATTCCCTTGCAATCAGTTCGGGTTCCAAGAACCCGGGTCAAATGATCAGATT
AAAAATTTTGCTTGTACAAGGTTCAAAGCCGAATTCCCGATCTTTGACAAG
ATTGATGTGAATGGCCCGTTTACTGCCCCGATTTATCAATTTCTCAAGTCGAACAGCGGAGGGTTCTTG
GGCGATTTGGTGAAGTGGAATTTTGAGAAGTTTTTAGTAGATAAAAATGGGAAAGTCGTTGAAAGATATCCTCCTACTACTTCCCCTCTTCAGATCGAG
AAGGACGTAAAGAAACTTCTT
GCTGCA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAGTCTCTTT AATACGGTGT TAAATCGAGG TCACAATGTG TCATCTTCAC CACCGTTCGT TGCGTATGGA CATCCTGTCT CCCGCCCCTA ATCTCCCATC GTGTGCAAAC CACCAACTTC  CATTCTAAAG TCTCCACCGA AACTTCCATC ATTTCCTCTT TTAAACCCTC AAAACCCCAT TCTTTTCTCC ACTCTTCACT TTCTTCAATC ACACAATCAA CAATGGCATC TATGCCTTGC  TCTTTAAACT TCACTTCCCC ATTTTTCAAT TTCTCTAAAT CCAACCGAAC CCAGTTCCCT TCTTGTCTCT CTGTTTCTTG CTTTGGAACT AGTTCTGTCC AATCTCTTTT AGGCTCATCA  AGTTCAGGGC TTTTCCAACA TGGGTTTGCT CTTAAAGCTG GAATCTTTTC TGGGTTTTCG TCTGATTCTC GTTCTGAATT TGGGGTTTTT GCTACAGCTG CCACTGGAAA GACTATTTAT  GATTTTACTG TAAAGGATAT CGATCGAAAG GATGTTCCTC TTTCCAAATT CAAGGGAAAG GTTCTACTTA TCGTCAATGT TGCATCGCAA TGTGGTTTGA CTTCATCTAA CTACTCCGAG  CTCACTCAAA TATATAACAA GTACAAAGAT CAAGGACTTG AAATATTGGC ATTCCCTTGC AATCAGTTCG GGTTCCAAGA ACCCGGGTCA AATGATCAGA TTAAAAATTT TGCTTGTACA  AGGTTCAAAG CCGAATTCCC GATCTTTGAC AAGATTGATG TGAATGGCCC GTTTACTGCC CCGATTTATC AATTTCTCAA GTCGAACAGC GGAGGGTTCT TGGGCGATTT GGTGAAGTGG  AATTTTGAGA AGTTTTTAGT AGATAAAAAT GGGAAAGTCG TTGAAAGATA TCCTCCTACT ACTTCCCCTC TTCAGATCGA GAAGGACGTA AAGAAACTTC TTGCTGCATA GTGTGATTAC  ATGTTCAACG TCCCAGAAAC CTCACTATAT CACAAACTAT ACGAGTTTAC GTTTTACATT TGTCATCAAA TGATTCATCT CTTTCGTTAT TGTGACAGAA AGCGAAATAG TATGCATAGC  CCGAAACCAT AGATTCGGTT TACCTGTATC TATCTGTGTA TGTAAATGAA TTTACTGCTT GGTACATCCT GGCTAAGTAA CAGTGGATAT CATTGTAAGT TGATTTGGTT TTTTTTAAAG  GTGTGAATTA TTCGTGAATG TCGGGAGGTC TAGCATACGT TGTCTTAACC GGGTTCGCGC TAGAGAGCCC ACTCGCACAA TACATCATCA ATTTAAACCC CTCAATGAGA AACTCCTATC 
ACCCAGACTC GAACTTGAG 

Retrieve as FASTA