Entry information : HaGPx05 (HanXRQChr07g0189821)
Entry ID 13677
Creation 2016-05-11 (Christophe Dunand)
Last sequence changes 2016-05-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaGPx05 (HanXRQChr07g0189821)
Name (synonym) HaGPx05 (HanXRQChr07g0189821)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaGPx05
start..stop
S start..stop
StGPx08 275 5e-96 1..157 1..161
LeGPx08 274 1e-95 1..157 1..161
VvGPx08 274 1e-95 5..156 9..160
NtGPx08-1A 273 2e-95 1..157 1..161
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 24582211..24582252 42 N° 2 24582763..24582839 77 N° 3 24582961..24583022 62 N° 4 24583116..24583234 119
N° 5 24583366..24583533 168 N° 6 24583626..24583742 117  
join(24582211..24582252,24582763..24582839,24582961..24583022,24583116..24583234 ,24583366..24583533,24583626..24583742)


exon

Literature and cross-references HaGPx05 (HanXRQChr07g0189821)
DNA ref. HanXRQ genome:   HanXRQChr07 (24582211..24583742)
Cluster/Prediction ref. HanXRQ:   HanXRQChr07g0189821
Protein sequence: HaGPx05 (HanXRQChr07g0189821)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   195
PWM (Da):   %s   21528.06  
PI (pH):   %s   5.35
Sequence 236
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANQPESIYDLTVKDANGVNVDLSIYKGKVLLVVNVASKCGLTNSNYSELNQLYAKYKAQGLEILAFPCNQFGDEEPGSNKQILEFVCTRFKSEFPVFDKIEVNGENAAPIYKFLKSGKRGIFGDDIQWNFAKFLVGRDGQAVGRYYPTTSPLTIERCAETCGIDSRQGPLVIRLTRSDQNALDLILVLKDLGLH

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAAACCAACCTGAATCCATCTATGATCTTACAGTCAAGGTAAACTACTTATACAACCCCAACACACACACACACACACACATGTTTTGTGACCATTAGTCTTTATCATCAACAACAA
ACTTGTGTTTTGATTAGGGTTATCTTTAATCTTTTGATTAAGAAACACAAGCAAGCAGACATTGATTTTTCAACTTTTTAATGTTTAAAGATCCATACCCATTAATAAATGATTGATCTT
GGTGGTATTTTAGCTTTCAACAAATCTTGAATCTGGGTTTTGAAGCTCCCAGTTTGACTTTTGAAGTCAACTAGGTTGAATATTAAACTGAAATTAGTTAGTCAACGCTTTTAATCTTCA
AGAAAATGTGGTAACCTGATATAGTGATATAGAATATGACATAGACTAAATGCAGAAGAATTTACAACAAAAACATTACATATTTGCATTTCAAAGGTAACAAGTTTGACCCAGAAAGTC
AACTTTGAAATCCTCACTCAACTTGTTGTACAATTGATTGTCATATTGCTGGTTCTCTTCTCTATATGCAGGATGCTAATGGAGTCAATGTTGACCTTAGCATCTACAAAGGAAAAGTTT
TACTTGTAGTCAATGTTGCCTCCAAATG
GTAATGATTCTTTTTCTGTTCTTCGGTTTTTCTGCTACTTGTGTATAATCATAATGCAGTTTTCCCAATTGGGTATAACTTGTTTAAATCTT
GTTTATGCAATGGTGAATCTTTGTGTCAGCGGGTTGACGAATTCGAATTACTCCGAGTTGAATCAACTCTATGCAAAATACAAAGCTCAAGGTTCGGTTTTTGAATGATAGCTTGTTATA
AGGATATGAATTTCAAGAATTTGATGCATGATTTGTATGTTTGACTATTAATGAGACTATGTAGGTTTGGAAATCTTGGCATTTCCGTGTAATCAATTTGGGGATGAGGAGCCCGGGAGT
AACAAGCAGATTTTAGAGTTTGTTTGTACTCGATTCAAATCCGAATTCCCTGTTTTCGACAAG
GTAAATCGGTTTTTTTGAATCATACTATCAGTTATTTAACAAAAAATTCTGTGAACT
AAACGTCCCTTATTCATATACGAATATATCTTGATGCAATTTATGTTTGTTTATGCACATGCAATGATTGTTAGATTGAAGTGAATGGCGAAAACGCTGCACCAATATACAAGTTCTTGA
AGTCGGGAAAAAGAGGTATCTTCGGGGACGACATTCAATGGAACTTTGCAAAATTTTTGGTTGGTAGAGACGGGCAGGCTGTTGGACGTTATTACCCGACAACTTCACCTCTCACAATCG
AG
GTAAAAGCAACCTCGTTTTATAAAAATCATTCTAAAACGAGTGTATATTTGTTATGGTGTATTTCTCTTAAAGCTATGATCATTTTGCAGAGAGATGTGCAGAAACTTGTGGAATAGA
TTCACGACAAGGTCCTCTCGTCATAAGATTAACGCGCAGCGATCAAAATGCTTTAGATTTGATTTTGGTTTTAAAAGACTTGGGGCTTCAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAAACCAACCTGAATCCATCTATGATCTTACAGTCAAGGATGCTAATGGAGTCAATGTTGACCTTAGCATCTACAAAGGAAAAGTTTTACTTGTAGTCAATGTTGCCTCCAAATGCG
GGTTGACGAATTCGAATTACTCCGAGTTGAATCAACTCTATGCAAAATACAAAGCTCAAG
GTTTGGAAATCTTGGCATTTCCGTGTAATCAATTTGGGGATGAGGAGCCCGGGAGTAACA
AGCAGATTTTAGAGTTTGTTTGTACTCGATTCAAATCCGAATTCCCTGTTTTCGACAAG
ATTGAAGTGAATGGCGAAAACGCTGCACCAATATACAAGTTCTTGAAGTCGGGAAAAAGAG
GTATCTTCGGGGACGACATTCAATGGAACTTTGCAAAATTTTTGGTTGGTAGAGACGGGCAGGCTGTTGGACGTTATTACCCGACAACTTCACCTCTCACAATCGAG
AGATGTGCAGAAA
CTTGTGGAATAGATTCACGACAAGGTCCTCTCGTCATAAGATTAACGCGCAGCGATCAAAATGCTTTAGATTTGATTTTGGTTTTAAAAGACTTGGGGCTTCAT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAACACAAA GAGGTCAAAT TCATGCTTCA TACGTTGGCA AAAATCGTCA CAGTTTTCAG CTCCAAATTT CAGCCAATCA GCCATGGCAA ACCAACCTGA ATCCATCTAT GATCTTACAG  TCAAGGATGC TAATGGAGTC AATGTTGACC TTAGCATCTA CAAAGGAAAA GTTTTACTTG TAGTCAATGT TGCCTCCAAA TGCGGGTTGA CGAATTCGAA TTACTCCGAG TTGAATCAAC  TCTATGCAAA ATACAAAGCT CAAGGTTTGG AAATCTTGGC ATTTCCGTGT AATCAATTTG GGGATGAGGA GCCCGGGAGT AACAAGCAGA TTTTAGAGTT TGTTTGTACT CGATTCAAAT  CCGAATTCCC TGTTTTCGAC AAGATTGAAG TGAATGGCGA AAACGCTGCA CCAATATACA AGTTCTTGAA GTCGGGAAAA AGAGGTATCT TCGGGGACGA CATTCAATGG AACTTTGCAA  AATTTTTGGT TGGTAGAGAC GGGCAGGCTG TTGGACGTTA TTACCCGACA ACTTCACCTC TCACAATCGA GAGATGTGCA GAAACTTGTG GAATAGATTC ACGACAAGGT CCTCTCGTCA  TAAGATTAAC GCGCAGCGAT CAAAATGCTT TAGATTTGAT TTTGGTTTTA AAAGACTTGG GGCTTCATTA AAGAACATGG TATTCATCAA GTTAGGAGGC CTGAGATATT CTCCTACTGC  TACTTAACCA GGGGTGTAAA TTTCTAACAT CAACACAAGC CTAACGCGAA ATTTACACTG TTAGTTTTTG TCTAAACGGG TCCGGGTCAG TTTTAGGTAG AACTCGTAAA CACGCTTAAC 
TAAACCACCA AAACGGCTTG TGTTTGAGTC AACTCTGGTC GAACCCGCAA ACACGTTTAG CTAAATCACC TAAACAACTT GTGTTTGGGT AAACATTACG GGTAAACGGG TT 

Retrieve as FASTA