Entry information : HaAOX04(HanXRQr2_Chr13g0598161 / HanXRQChr13g0411131)
Entry ID 13685
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-05-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2021-11-25 (Christophe Dunand)
Peroxidase information: HaAOX04(HanXRQr2_Chr13g0598161 / HanXRQChr13g0411131)
Name HaAOX04(HanXRQr2_Chr13g0598161 / HanXRQChr13g0411131)
Class Alternative Oxidase     [Orthogroup: AOX004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaAOX04
start..stop
S start..stop
HdebAOX04 724 0 1..370 1..370
HargAOX04 716 0 1..370 1..370
HnegAOX04 678 0 40..370 1..331
LeAOX04 435 6.87e-154 40..370 1..318
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13685' 'complement(join(138314784..138314840,138314945..138315433,138315915..138316043,138316123..138316557))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 138316123..138316557 433 N° 2 138315915..138316043 127 N° 3 138314945..138315433 487 N° 4 138314784..138314840 55
complement(join(138314784..138314840,138314945..138315433,138315915..138316043,1 38316123..138316557))


exon

Literature and cross-references HaAOX04(HanXRQr2_Chr13g0598161 / HanXRQChr13g0411131)
DNA ref. HanXRQ genome:   HanXRQChr13 (138316557..138314784)
Protein sequence: HaAOX04(HanXRQr2_Chr13g0598161 / HanXRQChr13g0411131)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   370 (304)
PWM (Da):   %s   42136.15 (32223.8)  
PI (pH):   %s   8.15 (4.73) Peptide Signal:   %s   cut: 28 range:28-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNHVNILKAIYKSSNHHAYFSPTNYQISHNTFNQSLDLEMNRKGT
IVATKASQLLLTQLRTRLFSTTSFTGSVITEPFNVPMSSTMGTTRLLTMPARNYSTHVSSGSSKDKKEDNDTKAV
SSYWGVAPPTLTKSDGSAWKWNCFR
PWEAYQADTTIDVKKHHNPVTWNDKIAFWIVQALKYPTYLYFQKKHIHHAVLLETVAAVPGMVGGMLLHTKSLRRFEQSGGWIKALLEEAENERM
HLMTFMDVYEPKWHERALVFAVQGVFFNAYFLAYLASPKLAHRITGYLEEEAVNSYTEFLNDLERGVMEDVPAPAIAIDYWCLPKNSTLKDVVRVIRADEAHHRDLNHYAS
DIHCQGHEL
KEYPAPIGYH

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCATGTCAACATCCTCAAAGCAATATATAAAAGCTCAAACCATCATGCATATTTTTCACCAACAAATTACCAAATATCACATAACACCTTCAATCAATCTCTAGATCTTGAAATG
AACCGTAAAGGTACTATTGTAGCAACAAAGGCGTCCCAGTTGCTATTAACGCAACTACGGACACGTTTGTTTTCCACTACAAGTTTTACAGGTTCAGTCATTACTGAACCTTTTAACGTT
CCCATGAGTTCAACCATGGGGACCACTAGGCTTTTGACCATGCCTGCTCGAAACTACAGCACGCATGTGTCTTCAGGCTCCAGCAAAGACAAGAAAGAAGATAACGATACAAAAGCGGTT
TCAAGCTATTGGGGCGTGGCTCCTCCCACGCTCACCAAGTCTGACGGGTCTGCTTGGAAATGGAACTGTTTTCGG
GTATGCGATCGCCCTCAACTCAGACATAGGTTTTATCGGAATAAT
GAAACTAACGATATTTGTTTTATAAAATTAATAGCCCCATGGGAAGCTTATCAAGCAGATACAACAATTGATGTTAAGAAGCACCACAATCCAGTCACTTGGAATGATAAAATTGCGTTT
TGGATCGTTCAAGCACTCAAGTATCCCACCTATTTATATTTTCAG
GTACATACGTTGCTATTTCTGTCGCTAATTCATGCTCGTTGCAATAGTTTTACAGCGACCAAAACCATCGCAATT
ATGTATTTGCAATGGTTTTGGCGGTCACAGACGGTCCATTTTGTATACGCTTCACTAGGGATGAGGAAATGGTACCGGGAACCGGTACCAGTACTGAATTTTTCAAACCGAGTTGATTTT
CGGTACCGACATTTAGCGTTTTCGGAACCGGTTCGGTACTAGTATTTACCGAATTTTATCCTCAAATACCGGTCTGTATCGGTACCGAACTGTACTGTACCGGGTATTTTCAGTACGGTA
CCGTTATTTTTGGATTTTCGGTACCGAGCTCATCCCTATGTGTGTTACGACCATTTTGATTTTGGTCTCAAATCAGTCGCTAATTTTGCGAAGATTTTTGTTGCTCATAATTTTAGTCGC
TTTTGCCCATATTTTCGTAGTGATAGTGACACCATTTACAATACAGAAAAAAAACACATACACCACGCGGTTCTACTAGAAACAGTCGCTGCGGTACCCGGAATGGTCGGAGGGATGTTG
CTGCACACGAAATCACTTCGTCGATTCGAGCAAAGCGGTGGGTGGATCAAAGCCCTACTAGAAGAAGCCGAAAATGAGCGAATGCATCTCATGACCTTCATGGATGTATACGAACCAAAA
TGGCATGAACGCGCCTTGGTCTTTGCAGTCCAAGGCGTGTTCTTCAACGCGTATTTCCTAGCCTATTTGGCATCACCAAAGCTCGCTCACCGGATCACCGGCTACCTCGAGGAGGAGGCC
GTGAACTCGTATACCGAGTTCCTAAACGACCTCGAAAGGGGGGTGATGGAAGATGTTCCAGCACCCGCCATCGCCATTGATTATTGGTGCTTACCGAAGAACTCGACACTGAAAGATGTT
GTTAGGGTTATACGTGCGGACGAAGCACATCACCGCGATCTTAACCATTATGCTTCG
GTAAGAATTTCGCTAATTTGCGTTATTTGGTCGCTAAATCTAATTAAGTCGTTGCTAATGATG
TGGGCTGTGATTAATGAATATTGTTATTTGTTTGGTTTCAGGAGACATTCATTGTCAAGGACATGAGCTAAAGGAGTACCCTGCTCCTATTGGATATCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCATGTCAACATCCTCAAAGCAATATATAAAAGCTCAAACCATCATGCATATTTTTCACCAACAAATTACCAAATATCACATAACACCTTCAATCAATCTCTAGATCTTGAAATG
AACCGTAAAGGTACTATTGTAGCAACAAAGGCGTCCCAGTTGCTATTAACGCAACTACGGACACGTTTGTTTTCCACTACAAGTTTTACAGGTTCAGTCATTACTGAACCTTTTAACGTT
CCCATGAGTTCAACCATGGGGACCACTAGGCTTTTGACCATGCCTGCTCGAAACTACAGCACGCATGTGTCTTCAGGCTCCAGCAAAGACAAGAAAGAAGATAACGATACAAAAGCGGTT
TCAAGCTATTGGGGCGTGGCTCCTCCCACGCTCACCAAGTCTGACGGGTCTGCTTGGAAATGGAACTGTTTTCGG
CCATGGGAAGCTTATCAAGCAGATACAACAATTGATGTTAAGAAG
CACCACAATCCAGTCACTTGGAATGATAAAATTGCGTTTTGGATCGTTCAAGCACTCAAGTATCCCACCTATTTATATTTTCAG
AAAAAACACATACACCACGCGGTTCTACTAGAAACA
GTCGCTGCGGTACCCGGAATGGTCGGAGGGATGTTGCTGCACACGAAATCACTTCGTCGATTCGAGCAAAGCGGTGGGTGGATCAAAGCCCTACTAGAAGAAGCCGAAAATGAGCGAATG
CATCTCATGACCTTCATGGATGTATACGAACCAAAATGGCATGAACGCGCCTTGGTCTTTGCAGTCCAAGGCGTGTTCTTCAACGCGTATTTCCTAGCCTATTTGGCATCACCAAAGCTC
GCTCACCGGATCACCGGCTACCTCGAGGAGGAGGCCGTGAACTCGTATACCGAGTTCCTAAACGACCTCGAAAGGGGGGTGATGGAAGATGTTCCAGCACCCGCCATCGCCATTGATTAT
TGGTGCTTACCGAAGAACTCGACACTGAAAGATGTTGTTAGGGTTATACGTGCGGACGAAGCACATCACCGCGATCTTAACCATTATGCTTCG
GACATTCATTGTCAAGGACATGAGCTA
AAGGAGTACCCTGCTCCTATTGGATATCAC

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATCATG TCAACATCCT CAAAGCAATA TATAAAAGCT CAAACCATCA TGCATATTTT TCACCAACAA ATTACCAAAT ATCACATAAC ACCTTCAATC AATCTCTAGA TCTTGAAATG  AACCGTAAAG GTACTATTGT AGCAACAAAG GCGTCCCAGT TGCTATTAAC GCAACTACGG ACACGTTTGT TTTCCACTAC AAGTTTTACA GGTTCAGTCA TTACTGAACC TTTTAACGTT  CCCATGAGTT CAACCATGGG GACCACTAGG CTTTTGACCA TGCCTGCTCG AAACTACAGC ACGCATGTGT CTTCAGGCTC CAGCAAAGAC AAGAAAGAAG ATAACGATAC AAAAGCGGTT  TCAAGCTATT GGGGCGTGGC TCCTCCCACG CTCACCAAGT CTGACGGGTC TGCTTGGAAA TGGAACTGTT TTCGGCCATG GGAAGCTTAT CAAGCAGATA CAACAATTGA TGTTAAGAAG  CACCACAATC CAGTCACTTG GAATGATAAA ATTGCGTTTT GGATCGTTCA AGCACTCAAG TATCCCACCT ATTTATATTT TCAGAAAAAA CACATACACC ACGCGGTTCT ACTAGAAACA  GTCGCTGCGG TACCCGGAAT GGTCGGAGGG ATGTTGCTGC ACACGAAATC ACTTCGTCGA TTCGAGCAAA GCGGTGGGTG GATCAAAGCC CTACTAGAAG AAGCCGAAAA TGAGCGAATG  CATCTCATGA CCTTCATGGA TGTATACGAA CCAAAATGGC ATGAACGCGC CTTGGTCTTT GCAGTCCAAG GCGTGTTCTT CAACGCGTAT TTCCTAGCCT ATTTGGCATC ACCAAAGCTC  GCTCACCGGA TCACCGGCTA CCTCGAGGAG GAGGCCGTGA ACTCGTATAC CGAGTTCCTA AACGACCTCG AAAGGGGGGT GATGGAAGAT GTTCCAGCAC CCGCCATCGC CATTGATTAT  TGGTGCTTAC CGAAGAACTC GACACTGAAA GATGTTGTTA GGGTTATACG TGCGGACGAA GCACATCACC GCGATCTTAA CCATTATGCT TCGGACATTC ATTGTCAAGG ACATGAGCTA  AAGGAGTACC CTGCTCCTAT TGGATATCAC TAAATTAAAA TATTGCGCTT GGTTGCTACA TAGTTATTCG ATGATTTGAA TTATGTGGAA TATGATTTCT ATATAGTTGT TCATATGATT 
GTATTATAGA AGTCGCATGA TTTTTTTTTA ATATTATTGT AAACATGTAC GTGTAATGCA TTTATTTATT TATACAATGA TCCTTAAGGG TAAGTTAC 

Retrieve as FASTA