Entry information : HaFer01 (HanXRQChr07g0203041)
Entry ID 13697
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-05-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaFer01 (HanXRQChr07g0203041)
Name (synonym) HaFer01 (HanXRQChr07g0203041)
Class Ferritin    [Orthogroup: Fer001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaFer01
start..stop
S start..stop
HaFer03 413 1e-148 1..241 1..243
HaFer06 383 8e-137 1..241 1..242
HaFer02 380 1e-135 22..241 30..248
LeFer01 376 9e-134 10..241 25..253
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 89909038..89909300 263 N° 2 89910541..89910624 84 N° 3 89911109..89911169 61 N° 4 89911237..89911324 88
N° 5 89911898..89911959 62 N° 6 89912495..89912560 66 N° 7 89912660..89912723 64 N° 8 89912816..89912871 56
join(89909038..89909300,89910541..89910624,89911109..89911169,89911237..89911324 ,89911898..89911959,89912495..89912560,89912660..89912723,89912816..89912871)


exon

Literature and cross-references HaFer01 (HanXRQChr07g0203041)
DNA ref. HanXRQ genome:   HanXRQChr07 (89909038..89912871)
Protein sequence: HaFer01 (HanXRQChr07g0203041)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   248
PWM (Da):   %s   27731.09  
PI (pH):   %s   5.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLKPPATLFFQNGVVFGNGVVSTPPAIVCAAAKGGSPPNSRTITGVVFEPFEEVKKELSLVPNAPQQSLARQKYADQSEAAVNEQINVEYNVSYVYHAMYAYFDRDNIALKGLAKFFKESSEEEREHAEKFMEYNKRGGKVKLQSILMPLSEFDHAEKGDALYAMELALSLEKLTNEKLLHMQVANKNNDVQLADFVENNFLGEQVKAIKKMSEYVAQLRRVGKGHGVWHFDQMLLDEVLPFDV

Retrieve as FASTA  
Remarks No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTCAAACCTCCTGCAACTCTCTTCTTCCAAAACGGTGTCGTTTTCGGAAACGGTGTAGTTTCGACTCCGCCGGCGATCGTTTGTGCGGCGGCGAAAGGTGGTTCTCCTCCGAAC
AGTAGAACGATTACAGGTGTGGTGTTTGAACCGTTTGAGGAAGTGAAAAAGGAGCTCAGTCTTGTACCTAATGCTCCTCAACAGTCTCTTGCTCGTCAAAAGTATGCTGATCAATCTGAA
GCTGCTGTTAATGAGCAGATTAA
GTGAGTTTTTTTTTTCGGTTTTTTGTTTTGTAGGTTGAATTTGTTGTTGTTGTTTTTTTTTTTTTTTTTTTTTGTTATGCATGCCAGGGGTTTGATA
AGGCGGTCTAGTTATCTGCATATTTTATTAGAGCTTTTTGGATAGATATAAGTGACTTGTGTCTGTGTACATAATATTTAACACATTATTCTGCATTTATCTATTTTTTTTTTTTGGTAT
GAACAATCCATATGTTGCTAATTAAATGAACTCGAGTTTTTACTGAAACTCATTAAAAAAAACAAGCTCAAGCTGGTTTGCGAGCTGAACGAGCTTTTATATTTATAGAATTTTATTATT
TTAATACTTATATATATATTAATATAATATTATGAATGCAAGTATAAATAAAAATATATTTAAATAATTATGAAATAAAATAACTAAATATATAATAAATTAGCCGAGCACGAGTTCGAT
CTTTAGACTGACTATAAAACAACCTCAAGCCAGCTTGCGAGCTGAACGAGTTTTTTATTTATAGAATTATATTATTTAGAGTAAATTGCCATTTTAGTCCCTGAGTTTTTGTCAAATTTG
CCATTTTAGTCAAAATAGTTTTTTTCCTCCTCTGGTCCTGACTTTTCTTTTTTCTTGTCATTTTGCTCACGTTGCCTAACTTAGTCTAAAAACCAGGTTATAATCAGGGGTATTTTTAGC
ATTAAATTATTATGAGGTTTATAACTTATGTTGTAAACTACCCCGGTTATCACTACACAACAGTTATGCCAAAAATACTCCTGGTTATAACCAAATTTTTAGACTGAGTTAGGTAATGTG
ATCAAAATGGCAAGAAAATGGAAAAGTCAGGGACCCAGAGGAGAAAAAAAACTATTTGGACTAAAATGACAATTTGGACCAAACCTCAGGGACTAAAATGGCAATTTACTCATTATTTAA
TATATTGAATATATATTAATATAATAATTATCATTATCATTGTGAATGAAAAGTATAAATAAAAATATATGTGTAAATAATTATTAAATAAAATAACTAAATATATAATAAGTGAGCTGA
GCTCGATCTTTAGAAATAAAGTTCCAAACAGCTAGAAATAAAGTTCCAAACAAGCTGCGCTCAAGCCTAAACGAGCTCTGTTCTTTTCTTTTACTGTCATATTGCATTTAATTAATTTTA
TTTAAAGGATTTTCTTGATGGTGACTTTATTCGTGTTTCTAATGATAATTTTGTTCCTTTCAGTGTTGAGTACAACGTTTCGTACGTGTACCATGCCATGTATGCATACTTCGATAGGGA
CAATATTGCTCTCAAGGGTTTAGCCAA
GTTAGTTACCAAAATCATTGTCATGTCAATTAATAACATATAGAGTTTAATGCCATTTTAATCCCTGTGGTGGTTTGGGCCATTTTGGCAGTT
TAGTCCAAAGGTTTCTTTTTTCGCATGTGGGTTCAAAAAGGTTTCACCGTTGCCATTTTAGTCCACTGGGTTAACTTCATCTATTTTTTCTGTTAACGAGAAGGGCAATTCGGTCATTTT
ATATGGCCGAATTGCCTTTCTAGTTAACAGAATTACATATAAAATGACCGAATTGCCCTTCTCGTTAACAGAAAAAATGGATGAAGTTAACCCAGTGGACTAAAATGGCAACGGTGAAAC
CTTTTTGGACCCACATGTGAAAAATGAAACCTTTGGACTAAACTGCCAAAATGGCCCAAACCACAGGGACTAAAATGGCATTCAACTCTAATATATATTAATAATCAGTGTGACAACATT
TACCCTGACTATGCTACATAAATACTTACAGATTCTTTAAGGAGTCCAGCGAAGAGGAAAGGGAACATGCCGAAAAGTTTATGGAATACCAGGTGTTTGATTCTAGCATTTCTTCACTTA
ATTGTCACTGATTATAATCATAAAGTTTTTCTGTTTTAGAACAAACGCGGTGGGAAAGTGAAGTTGCAATCTATTTTGATGCCTTTATCCGAGTTTGATCATGCAGAGAAAGGAGATGCA
CTTTATG
GTAAGTTTTGTGTTATGATATGTTCGATTGCCCAAATATTAGTTGCTACATTACATTAAGTGAGATCTTGTGAATCACTTTGATTATTATTCGAAGAGTAAAATGCAATTTTC
GTCCCTGAGGTTTAGCCAGTTTTGCGACTTTCATCCAATGGTTTGTTTTTCCACTATATGGATCCAAAAGGTTTGAAATCTTGCCATTTCCATCCGGCTCGTTAACTCCATCCATTTTTC
TCTGTTTAGTAAGGGGTATTTCCGTCTTTTTTGTTAACTTAAAGGGCAATTCGGTCATTTTCACTTTATGTACAAGCATTTAGCATAATGTACATAAAGTGAAAATGACCAAATTACCCT
TTAAGTTACCAAAAAAATTGGAAATACCACTGTCTTGACGGAGAAAAATGGATTGAGTTAACGAGACGGATGAAAATAGCAAGATTTCAAACCTTTTGGATCCACATGCGAAAAACAAAC
CTATGGACGAAAGTCGCAAAACTGGCCAAACCTTAGGGACGAAAATGGCATTTTACTCTTGATTGAATTATTATGTTTCATTGGTTTGTTTATTTTGTAGCAATGGAGCTTGCATTGTCG
CTGGAGAAATTAACAAATGAGAAACTACTACACATGCAAGCG
GTATGACATGTTCTTTTGCATTTTGTGTATGCCGATTAATGTTTAATATGAAGATCAAGAAAATGTGGGATTTGGGTG
TATGTTTAAAAAATGCTTGAGTCGTGCGCCTCAAGGCGCGCCTCGAGGCGAAACGACCAAAAAACGAGTCTGAGGCGCGCCTCATGGGGTTTTAACTGCATATGCGCCTCAGAGGAGTTG
AGGCGCTAAAAAAGGTTGCGCCTCAGGTGCGCCTCATGGGATTTTCATAGTTGTTTTTGATGTTTTTGACTTTTTGTGTCAATTTCAAGCATTTCATGTCTTTTTATGTATGTTTTTGAT
GATTTTGATGAATCTGATGATGAAATTAGTTGGTATTATTATTTTTATAATATATATAATTTTTATATTTATTTATTAATACCGCCTCGGCCTTACGCCTCATTTTGCCTCGAGGCTTAC
GCCTCGTAAGGCAAAGGGAAAACGCCTCGAAACTCGTTTCCGTTCTTTTAAACAATTAAACCTCGGGTGTATGAATTGTGATATTTGATGAGAACAGGTAGCCAACAAGAACAATGATGT
CCAATTAGCTGATTTTGTTGAAAACAACTTCTTGGGTGAACAG
GTAGAAATATAATTTATAAATTCGACTACTTTATAAATATCCGGTAGTTCATTTGCGCCACGAGGGGAAGTTGATAA
TTTTTTTTCATTTTGTTAAAAGGTCAAGGCGATTAAAAAGATGTCTGAATATGTTGCTCAGTTAAGAAGAGTCGGCAAAGGACACGGTAAACTTATTCGTAACCAATTTTTCACTTAAAA
TTGAATGTATCAAATTATTATTCGGTCACTAGAGATGACGATTTTCTTGCAATATCAGGAGTTTGGCATTTTGATCAGATGCTGCTCGACGAAGTGCTGCCGTTTGATGTATTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTCAAACCTCCTGCAACTCTCTTCTTCCAAAACGGTGTCGTTTTCGGAAACGGTGTAGTTTCGACTCCGCCGGCGATCGTTTGTGCGGCGGCGAAAGGTGGTTCTCCTCCGAAC
AGTAGAACGATTACAGGTGTGGTGTTTGAACCGTTTGAGGAAGTGAAAAAGGAGCTCAGTCTTGTACCTAATGCTCCTCAACAGTCTCTTGCTCGTCAAAAGTATGCTGATCAATCTGAA
GCTGCTGTTAATGAGCAGATTAA
TGTTGAGTACAACGTTTCGTACGTGTACCATGCCATGTATGCATACTTCGATAGGGACAATATTGCTCTCAAGGGTTTAGCCAAATTCTTTAAGGAG
TCCAGCGAAGAGGAAAGGGAACATGCCGAAAAGTTTATGGAATACCAG
AACAAACGCGGTGGGAAAGTGAAGTTGCAATCTATTTTGATGCCTTTATCCGAGTTTGATCATGCAGAGAAA
GGAGATGCACTTTATG
CAATGGAGCTTGCATTGTCGCTGGAGAAATTAACAAATGAGAAACTACTACACATGCAAGCGGTAGCCAACAAGAACAATGATGTCCAATTAGCTGATTTTGTT
GAAAACAACTTCTTGGGTGAACAG
GTCAAGGCGATTAAAAAGATGTCTGAATATGTTGCTCAGTTAAGAAGAGTCGGCAAAGGACACGGAGTTTGGCATTTTGATCAGATGCTGCTCGAC
GAAGTGCTGCCGTTTGATGTATTG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GATTTTCTTC TTATCATTAT CAGTTTCAAT TTCTCGTTAA AATCATGCTT CTCAAACCTC CTGCAACTCT CTTCTTCCAA AACGGTGTCG TTTTCGGAAA CGGTGTAGTT TCGACTCCGC  CGGCGATCGT TTGTGCGGCG GCGAAAGGTG GTTCTCCTCC GAACAGTAGA ACGATTACAG GTGTGGTGTT TGAACCGTTT GAGGAAGTGA AAAAGGAGCT CAGTCTTGTA CCTAATGCTC  CTCAACAGTC TCTTGCTCGT CAAAAGTATG CTGATCAATC TGAAGCTGCT GTTAATGAGC AGATTAATGT TGAGTACAAC GTTTCGTACG TGTACCATGC CATGTATGCA TACTTCGATA  GGGACAATAT TGCTCTCAAG GGTTTAGCCA AATTCTTTAA GGAGTCCAGC GAAGAGGAAA GGGAACATGC CGAAAAGTTT ATGGAATACC AGAACAAACG CGGTGGGAAA GTGAAGTTGC  AATCTATTTT GATGCCTTTA TCCGAGTTTG ATCATGCAGA GAAAGGAGAT GCACTTTATG CAATGGAGCT TGCATTGTCG CTGGAGAAAT TAACAAATGA GAAACTACTA CACATGCAAG  CGGTAGCCAA CAAGAACAAT GATGTCCAAT TAGCTGATTT TGTTGAAAAC AACTTCTTGG GTGAACAGGT CAAGGCGATT AAAAAGATGT CTGAATATGT TGCTCAGTTA AGAAGAGTCG  GCAAAGGACA CGGAGTTTGG CATTTTGATC AGATGCTGCT CGACGAAGTG CTGCCGTTTG ATGTATTGTG AAGGTTTTGA GGTCATTTCG ATATTAGCTG ATCGGCTAGG TGTGTAGTTC 
TTTATTTTCC TACTATGTTT TTTTTTTTTT TTTCAAATGC TTGACCTTAT T 

Retrieve as FASTA