Entry information : HaFer02 (HanXRQChr08g0221961)
Entry ID 13698
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-05-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaFer02 (HanXRQChr08g0221961)
Name (synonym) HaFer02 (HanXRQChr08g0221961)
Class Ferritin    [Orthogroup: Fer001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaFer02
start..stop
S start..stop
HaFer06 422 3e-152 1..252 1..246
HaFer03 421 1e-151 1..251 1..246
HaFer01 384 8e-137 1..248 1..241
LeFer02 384 9e-137 37..252 39..251
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51963582..51963865 284 N° 2 51964474..51964557 84 N° 3 51964643..51964703 61 N° 4 51964796..51964883 88
N° 5 51965003..51965064 62 N° 6 51965189..51965254 66 N° 7 51965331..51965394 64 N° 8 51965792..51965838 47
join(51963582..51963865,51964474..51964557,51964643..51964703,51964796..51964883 ,51965003..51965064,51965189..51965254,51965331..51965394,51965792..51965838)


exon

Literature and cross-references HaFer02 (HanXRQChr08g0221961)
DNA ref. HanXRQ genome:   HanXRQChr08 (51963582..51965838)
EST ref. GenBank:   DY923528.1 [5' end]
Protein sequence: HaFer02 (HanXRQChr08g0221961)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   252
PWM (Da):   %s   28402.11  
PI (pH):   %s   5.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFLRAPLTPTFFTGTTTDESFNCPLFSSPVTTSLNTVCAAVKGGSSNHRPLTGVVFEPFEEVKKELNLVPSGYHQSLARQKYADESEASINEQINVEYNVSYVYHAMYAYFDRDNVALKGLAKFFKESSEEEREHAEKFMEYNKRGGKVKLQSIIMPLSEFDHEEKGDALYAMELALSLEKLTNEKLLNLHVACRNNDVQLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFNQMLLNEGAA

Retrieve as FASTA  
Remarks Complete sequence from genomic and EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCTCAGAGCCCCTCTCACTCCCACTTTCTTCACCGGAACCACCACCGATGAGAGTTTTAACTGTCCTCTGTTTTCATCCCCTGTTACGACGTCGTTAAATACCGTTTGTGCGGCG
GTGAAAGGCGGTTCTTCGAACCATCGTCCGCTTACTGGGGTTGTGTTTGAGCCGTTTGAGGAGGTCAAGAAAGAGCTTAATCTTGTACCCTCTGGTTATCACCAGTCTCTTGCTCGACAA
AAGTATGCTGATGAGTCTGAAGCTTCTATTAATGAACAGATCAA
GTGAGTTTTTTTCTACTTTCATTGGAGGTTTTTTGGTTTGAATTTCGGATTTTGCTGTTAGTGTGATTATTTAGTC
TCACTTTATGTTTAGTTTATGAAACTTCGAAAGTTGAATTTTGTGTGATGCCAAAGTGCCCACCATGTGTGATTGTGTTCGATAAAAGTTGTAGGAGAACAAGTGTTAAAAGATGATTGC
AGACCATGTGTTTGATGAAAGTTGTAGGAGAACCTGTGTTAAAGATGGTTGCCCACCATGTGTTTGATCAAGGTTGTAGGAGAACCAGTGTCAAATATGATTGCCCACCATGCGTTTGAT
GAAAGTTGTAGGAGAATAAGTGCCCACCATGTGTTTGATAAAAGTTCTAAAAGAACATCAACTGAAAACCATTTTGGCCAACACCTCATGATAAAATATTGATGACTTTATACATACTTT
ATTTGATATTAGTGGAAGTTCTTTTATGGGATTATATTTAGACAAGGGCAGGGTCCTGAAATTCGATAGAGGTAAAGGGTAAAGGGTTCTTATAAAATCTTTTCTTTTTGTTTTGTCATC
TTTGATTTGAGCTTTTGTTTATGCTGATGATTTTTTTTGGGTCTGTTTTCAGTGTTGAGTATAATGTCTCCTATGTGTACCATGCTATGTATGCCTACTTTGATAGGGATAATGTTGCTC
TCAAGGGCTTAGCCAA
GTAAGTTACTACTACTGTTTTATATATCTATATATTTTTCAAAACCATCTGGTTTTATTCATTTACAACTCGTTAACCTTGATAGGTTCTTTAAGGAGTCTAGT
GAAGAAGAAAGAGAACATGCTGAAAAGTTCATGGAATACCAG
GTGTTGGGTCATTAATCACCCATCTTTAGCTTCTATTTGCTTTAGATTTGAAAACCGGTCGAACTAATATATCGTTTG
TATTTTATTTTCAGAACAAACGAGGTGGGAAGGTGAAGTTGCAATCGATTATAATGCCACTATCCGAGTTTGACCATGAAGAAAAAGGAGACGCATTGTATGGTAAGTTTTTGTACTTAT
GTATATCCCTGATTAGTTCATTGTAAGTTAAATTTGATTAATCAAGTTCTTTAAAGTTATGGTATAGTTCTGAACTTTTTCTTACCTGCTTTCGATTCTAGCAATGGAGCTTGCGTTGTC
ATTGGAGAAGCTGACAAATGAGAAGCTTCTGAACCTCCATGAG
GTGTTACATACTAATCGCCTTTTGTGTTCATTTAGTGCACAAAAAAATGTTTACATAGAATGTATACCAAGCATAGT
CACAACTAAATTCAAGTTTTTGACATGCAACTTTGTGATGAAAACAGGTGGCCTGCAGGAACAATGATGTGCAATTAGCTGATTTTGTAGAAAGCGAGTTTCTTGGTGAACAGGTTAATA
TCAAATTTTACTGTTAACTTAACCATTGAGTTTACAATGATACTGATATCTATTTTTTTCGAATAAAAGGTTGAAGCAATCAAGAAGATATCCGAGTATGTTGCTCAACTAAGAAGAGTT
GGCAAAGGGCATG
GTATAATATTCAAAAACTCAATTGTTCAGATTCTCTTTTATCTTTATGAATGCGTAGGTCACAAGTTGCTTTGTAATTTGAGGAGTCGATATGGTAGTTAACTAGTT
ATTAAAATGAATCTAGGAGGTATTACGCGTTAAAAGTATACGTTGGAACACTTTTAACCTGTTGACCCATTTGATCCGGTTTTTCATTTTTAGCTAAATCTTCTTTTTTTAATATTAAAA
TATAATCCGAATCGACCCGTTACTAAGTTAATGGGTCAAAACCACCACCTTCGTTAAAAATAGTAACACTATGTTTCGAATTTCAAGTGTTTGAAGTTCTGATCCTTTGTGATTTGAGAT
ACCATTATGTTATATTTACTAAAAACGGTGACTTTTATTCATATTTTCAGGTGTTTGGCACTTCAATCAGATGCTCCTGAATGAAGGTGCTGCTGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCTCAGAGCCCCTCTCACTCCCACTTTCTTCACCGGAACCACCACCGATGAGAGTTTTAACTGTCCTCTGTTTTCATCCCCTGTTACGACGTCGTTAAATACCGTTTGTGCGGCG
GTGAAAGGCGGTTCTTCGAACCATCGTCCGCTTACTGGGGTTGTGTTTGAGCCGTTTGAGGAGGTCAAGAAAGAGCTTAATCTTGTACCCTCTGGTTATCACCAGTCTCTTGCTCGACAA
AAGTATGCTGATGAGTCTGAAGCTTCTATTAATGAACAGATCAA
TGTTGAGTATAATGTCTCCTATGTGTACCATGCTATGTATGCCTACTTTGATAGGGATAATGTTGCTCTCAAGGGC
TTAGCCAA
GTTCTTTAAGGAGTCTAGTGAAGAAGAAAGAGAACATGCTGAAAAGTTCATGGAATACCAGAACAAACGAGGTGGGAAGGTGAAGTTGCAATCGATTATAATGCCACTATCC
GAGTTTGACCATGAAGAAAAAGGAGACGCATTGTATG
CAATGGAGCTTGCGTTGTCATTGGAGAAGCTGACAAATGAGAAGCTTCTGAACCTCCATGAGGTGGCCTGCAGGAACAATGAT
GTGCAATTAGCTGATTTTGTAGAAAGCGAGTTTCTTGGTGAACAG
GTTGAAGCAATCAAGAAGATATCCGAGTATGTTGCTCAACTAAGAAGAGTTGGCAAAGGGCATGGTGTTTGGCAC
TTCAATCAGATGCTCCTGAATGAAGGTGCTGCTGCC

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACACACTCAT CTTCATCCCC TTCATCACTC ACTCACCATC TCAACAAACA ATCCCATATT GTTCATAATT TCTCAACAAA ATTATGTTTC TCAGAGCCCC TCTCACTCCC ACTTTCTTCA  CCGGAACCAC CACCGATGAG AGTTTTAACT GTCCTCTGTT TTCATCCCCT GTTACGACGT CGTTAAATAC CGTTTGTGCG GCGGTGAAAG GCGGTTCTTC GAACCATCGT CCGCTTACTG  GGGTTGTGTT TGAGCCGTTT GAGGAGGTCA AGAAAGAGCT TAATCTTGTA CCCTCTGGTT ATCACCAGTC TCTTGCTCGA CAAAAGTATG CTGATGAGTC TGAAGCTTCT ATTAATGAAC  AGATCAATGT TGAGTATAAT GTCTCCTATG TGTACCATGC TATGTATGCC TACTTTGATA GGGATAATGT TGCTCTCAAG GGCTTAGCCA AGTTCTTTAA GGAGTCTAGT GAAGAAGAAA  GAGAACATGC TGAAAAGTTC ATGGAATACC AGAACAAACG AGGTGGGAAG GTGAAGTTGC AATCGATTAT AATGCCACTA TCCGAGTTTG ACCATGAAGA AAAAGGAGAC GCATTGTATG  CAATGGAGCT TGCGTTGTCA TTGGAGAAGC TGACAAATGA GAAGCTTCTG AACCTCCATG AGGTGGCCTG CAGGAACAAT GATGTGCAAT TAGCTGATTT TGTAGAAAGC GAGTTTCTTG  GTGAACAGGT TGAAGCAATC AAGAAGATAT CCGAGTATGT TGCTCAACTA AGAAGAGTTG GCAAAGGGCA TGGTGTTTGG CACTTCAATC AGATGCTCCT GAATGAAGGT GCTGCTGCCT  GAAGGAGTTA AATTTTGTTG TTTCTACTTG TGGTATGTGA AATCTTGTGG GTTTGATTGT GTCTTTCTCT TATGTGTTAT GAAGTAAACC CGGTCTAGTT TTAGTGTTGG TGTTGGTATT  GCCGTTTTTT TTGTGAATCT TTTAGAGCCA GTCATTTGGT TTGTGCTCAT AGCTACTGTA TGGCTTTGCA ATCAGTTGGT GCAATTAGGA AGTGTCCCTA AAATCAAATC AACATAATTC  AAATGAACAT ATGACACGAT CGGTCAGATT TTTTTCTTCT TATTATTATT AACTGTGTAT ATATCAATAT ATGGTATGTA TTAACAAACC ATTGCTTAAA GTTAACTACA TGGATGGTTT  TGTTAGGGGT GTTCATGAGT TTGTTCAGCT AGTTTTGATG AAAATTTTGG GTCGAACGAT CGAACCATGA AGGCGCTAAC TACGGTTTCG GAAAACAACA AGCAAACTGA CTAGATTGGA  TGATTGACCG AACAGGCCGG TTTTACCTTT TTATCAACTT TTTTTTCGAA AATATATTGG CCAAACAAGC CGGTTTTACC TTTTTATTAA CTTTTTTTTT TGCGAAAATA CATCAAAATT  AAAAAAATAA CAATGATGGT TATAAAGGTT ATAAAAGTTA AAGGCATGTT CCACGTTTCC AATTGTTAAA ACCATCAAAC CATGAAAACC GAGCGGTTGG GATCTTAAAT CGGATGACTA  GTTTTGGTGC ATCAAAATTA GTGTTCCTAT GACTATAATA TGTGTCAACA TTAATCTCCA AATGACTAAA CATTCATCAA GAGCTTATTA CCTGATTGTG GTTGTATATA ACTTAAGAAT  ATTTACATTT AAAGAGATGC CAAAGAACCA AAGTTTTATT TTCAGTAGGA TCGGTTTTGC AATTCAAAAG GGGGATTATG GGGCAGCTTG TTGCCCGTTT ACCTACCGCT ATTATGTAAT 
TGAATGCTAA ATTTCAAATA AAAAAGAGAT GTTGGATGAT ATATATTGCT GATTCT 

Retrieve as FASTA