Entry information : HaFer06 (HanXRQChr17g0560901)
Entry ID 13702
Creation 2016-05-12 (Christophe Dunand)
Last sequence changes 2016-05-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaFer06 (HanXRQChr17g0560901)
Name (synonym) HaFer06 (HanXRQChr17g0560901)
Class Ferritin    [Orthogroup: Fer001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaFer06
start..stop
S start..stop
HaFer03 428 2e-154 1..245 1..246
HaFer02 410 1e-147 1..246 1..252
LeFer02 386 5e-138 1..246 1..251
HaFer01 383 8e-137 1..242 1..241
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 153955289..153955554 266 N° 2 153956178..153956261 84 N° 3 153956358..153956418 61 N° 4 153956533..153956620 88
N° 5 153956716..153956777 62 N° 6 153956861..153956926 66 N° 7 153957003..153957066 64 N° 8 153957181..153957227 47
join(153955289..153955554,153956178..153956261,153956358..153956418,153956533..1 53956620,153956716..153956777,153956861..153956926,153957003..153957066,15395718 1..153957227)


exon

Literature and cross-references HaFer06 (HanXRQChr17g0560901)
DNA ref. HanXRQ genome:   HanXRQChr17 (153955289..153957227)
EST ref. GenBank:   GE520999.1
Protein sequence: HaFer06 (HanXRQChr17g0560901)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   246
PWM (Da):   %s   27531.88  
PI (pH):   %s   5.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLRAPPTLSFLTRPTSNETQYRSLPPSTVVCAATKGGSSNHAPLAGVVFEPFEEVKKELNLVPSVPQQSIARQKYADAAEASVNEQINVEYNVSYVYHAMYAYFDRDNVALKGLAKFFKESSEEEREHAEKLMEYNKRGGKVKLQSIIMPLSEFDHEEKGDALYAMELALSLEKLTNDKLLNLHVANENNDVHLADFVESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLNDGAA

Retrieve as FASTA  
Remarks Complete sequence from genomic and EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCTCAGAGCCCCACCCACTCTCTCTTTCTTGACCCGACCCACCTCCAATGAAACCCAGTACCGGTCTCTGCCGCCGTCCACCGTCGTCTGTGCGGCGACGAAGGGTGGGTCTTCA
AACCATGCCCCACTTGCTGGGGTTGTCTTTGAGCCGTTTGAGGAGGTGAAGAAAGAACTTAATCTTGTACCTTCGGTTCCTCAACAGTCTATTGCTCGCCAGAAATATGCTGATGCGGCT
GAAGCTTCTGTTAATGAACAGATCAA
GTGAGTTTTCTTATTTATTATTACTCAGTTTTTACTGTTAATTTATGTAAATGTTTGCAATTAAAGTGCGATTGGTTATTGTCAGTCTATGTTT
GGTAAGTGAATGTCTGTTGTTTGGGAAAAAAAAGTCGAAGTTGATGTGAAGATAAATTGCCCACCAAGTGTTTGATATAAGGCCTAGGAGAAACAGTGTCATACATTAATGCTGGGAAAC
CGTTTTTAGAGAGCGGCTCGCCAGAAGCTCAAATTGAGCTGAGTTTAACGGGTTCGAGCTCGAGCCCAAAAAATAAGCCTGTTTAACAAATGAGTCCAAGCCCAAGCTTCACTTATGGGG
CTCGAGCAGGCTCACAAGCTTGAAGCGGGCCTATTATTTAATATTAATATGATTAAAAAATCTAAATAATATATATATATATATATATATATATTGTGTTATGTAAGTAAAATTAATAAT
AACAAACATATACATGTAGGGAGACGTTCAATCATTGGGAGGTATAAGTATTTAAGGAGAAAAAATTAGCCGTTCTAAAAGAAATAATAATAAACATATATAAGTTTATTTTTTTTTGAA
GGGCAAATTAGAATCACTGATGAGTTGTTGTTTTTTGGTCTCATTTCAGTGTTGAGTATAATGTTTCCTATGTGTATCACGCTATGTATGCATACTTTGATAGGGACAATGTTGCTCTCA
AAGGCTTAGCCAA
GTAAGTTACTACTCCCATCTTAATATTTTTTACAATAACCAAGTGAAACGCGGTTTTTGTCTGGTTTATTGACTTGTGATACATTAAACGTTATAGGTTCTTTAAGG
AGTCTAGCGAAGAAGAAAGGGAACACGCTGAGAAGTTAATGGAGTACCAG
GTTTTCGAGCATTTATCAGCTACCTCTAGTTTAATTTGCTTTATATGTGAGAAAATGGGTAGTGGCACTT
TCTCGGGTGTGGATAAAACTGGTAGAATTTTTTTAAATTTGCAGAACAAACGAGGCGGGAAAGTAAAGCTGCAATCGATTATAATGCCATTGTCTGAGTTTGATCATGAAGAGAAAGGAG
ACGCTTTGTATG
GTAAGTTTTGTATATACATATACCTTCTGTGTTTTTAATAAGCAAATATCAAAGTTATGGTTGTTAACTTGTTTTTAACTACTTTTTTTTCCTAGCAATGGAGCTTGC
ATTGTCATTGGAGAAGTTGACAAATGATAAACTTCTAAACCTCCATGAG
GTGCAAAAAATTACAGAAAATTAAAATATAGCATAACCGCAACTTAATTCGTGTTTCTGACATGCAACTTT
GGAATGAAACAGGTAGCCAATGAGAACAATGATGTGCATTTAGCTGATTTTGTGGAGAGTGAGTTTCTTGGTGAACAGGTGAATATCAAATTTCACTTTAAGTTAACCGTTGGGCTTATA
GTGATTCTAATATCTATTTTTTTTTTAATAAAAGGTTGAAGCAATTAAGAAGATATCCGAGTATGTTGCTCAACTAAGAAGAGTCGGCAAAGGGCATGGTAAAAGTTTCAAAATTTCATT
TCACATTTTAATTTATGAAGGTCTAGGTGTCATTTAATTTGACGTACCGTTGTTCATAGTCTTCAAAAATAGTAACCGTATTCCAATTTCAGGTGTTTGGCATTTTGATCAGATGCTCCT
GAATGATGGTGCTGCTGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCCTCAGAGCCCCACCCACTCTCTCTTTCTTGACCCGACCCACCTCCAATGAAACCCAGTACCGGTCTCTGCCGCCGTCCACCGTCGTCTGTGCGGCGACGAAGGGTGGGTCTTCA
AACCATGCCCCACTTGCTGGGGTTGTCTTTGAGCCGTTTGAGGAGGTGAAGAAAGAACTTAATCTTGTACCTTCGGTTCCTCAACAGTCTATTGCTCGCCAGAAATATGCTGATGCGGCT
GAAGCTTCTGTTAATGAACAGATCAA
TGTTGAGTATAATGTTTCCTATGTGTATCACGCTATGTATGCATACTTTGATAGGGACAATGTTGCTCTCAAAGGCTTAGCCAAGTTCTTTAAG
GAGTCTAGCGAAGAAGAAAGGGAACACGCTGAGAAGTTAATGGAGTACCAG
AACAAACGAGGCGGGAAAGTAAAGCTGCAATCGATTATAATGCCATTGTCTGAGTTTGATCATGAAGAG
AAAGGAGACGCTTTGTATG
CAATGGAGCTTGCATTGTCATTGGAGAAGTTGACAAATGATAAACTTCTAAACCTCCATGAGGTAGCCAATGAGAACAATGATGTGCATTTAGCTGATTTT
GTGGAGAGTGAGTTTCTTGGTGAACAG
GTTGAAGCAATTAAGAAGATATCCGAGTATGTTGCTCAACTAAGAAGAGTCGGCAAAGGGCATGGTGTTTGGCATTTTGATCAGATGCTCCTG
AATGATGGTGCTGCTGCT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATCATCTT CTTCATCACT CACTCAAAAC CCTTCATTTC CCCTGTTCCA TAACCTCACA ATTCCTCTAA CTACAATGCT CCTCAGAGCC CCACCCACTC TCTCTTTCTT GACCCGACCC  ACCTCCAATG AAACCCAGTA CCGGTCTCTG CCGCCGTCCA CCGTCGTCTG TGCGGCGACG AAGGGTGGGT CTTCAAACCA TGCCCCACTT GCTGGGGTTG TCTTTGAGCC GTTTGAGGAG  GTGAAGAAAG AACTTAATCT TGTACCTTCG GTTCCTCAAC AGTCTATTGC TCGCCAGAAA TATGCTGATG CGGCTGAAGC TTCTGTTAAT GAACAGATCA ATGTTGAGTA TAATGTTTCC  TATGTGTATC ACGCTATGTA TGCATACTTT GATAGGGACA ATGTTGCTCT CAAAGGCTTA GCCAAGTTCT TTAAGGAGTC TAGCGAAGAA GAAAGGGAAC ACGCTGAGAA GTTAATGGAG  TACCAGAACA AACGAGGCGG GAAAGTAAAG CTGCAATCGA TTATAATGCC ATTGTCTGAG TTTGATCATG AAGAGAAAGG AGACGCTTTG TATGCAATGG AGCTTGCATT GTCATTGGAG  AAGTTGACAA ATGATAAACT TCTAAACCTC CATGAGGTAG CCAATGAGAA CAATGATGTG CATTTAGCTG ATTTTGTGGA GAGTGAGTTT CTTGGTGAAC AGGTTGAAGC AATTAAGAAG  ATATCCGAGT ATGTTGCTCA ACTAAGAAGA GTCGGCAAAG GGCATGGTGT TTGGCATTTT GATCAGATGC TCCTGAATGA TGGTGCTGCT GCTTGATGGA TTAAGTGCTG TTTTAGTTGT  AGCTTTAGAG ATTGTGGGCG ATTTAAGTTG TCTAAGTCCT TTTGTGACTT GTTATGCTAG TGACCGGTTA AAACTGGGTG TGAATGGTAT GCGAAATCTT GTGGCTTGAT TGTGTCTTTC  TCTTTTGTGT TATCGAGTTG GCTCGGTCTT TCTTGGTGAT TTTATGTGAA TCTTTTAGAG CCAGAAAATT GGTTTGAGGC TCAGAGCCAT TGCATGGTCA ATTAGTACAA ACAGGACCAT  AATATATATA TGGTTAGGGG TCGGCTTCAC ACAAGATTTA AGGGCCCCTA AAATCAATGT TTATGGTGTT TATGATTTTG AAAGAAAGAT TTAGATAGTT CTTGATCTGC TATGAAAATC 
ATACTATATT TGACCCAAAA ACCTAAATTT TAAAATTATG GCTTTAAAAC AGACTTAACA TTGGATCATT GAATATAAAT TTTATATTTG TATAGTTATA TTGATTT 

Retrieve as FASTA