Entry information : HaUCC08 (HanXRQChr15g0486951)
Entry ID 13714
Creation 2016-05-13 (Christophe Dunand)
Last sequence changes 2017-11-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaUCC08 (HanXRQChr15g0486951)
Name (synonym) HaUCC08 (HanXRQChr15g0486951)
Class Uclacyanin    [Orthogroup: UCC002]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaUCC08
start..stop
S start..stop
HaUCC06 230 2e-77 1..194 62..234
ThasUCC06 171 1e-54 29..165 24..160
AtUCC06 159 3e-50 27..126 23..122
HaUCC04 115 4e-33 17..194 9..181
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 98929411..98929588 178 N° 2 98930536..98930942 407  
join(98929411..98929588,98930536..98930942)


exon

Literature and cross-references HaUCC08 (HanXRQChr15g0486951)
DNA ref. HanXRQ genome:   HanXRQChr15 (98929411..98930942)
Protein sequence: HaUCC08 (HanXRQChr15g0486951)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   195 (168)
PWM (Da):   %s   19839.39 (16952.0) Transmb domain:   %s   o5-22i171-193o (o5-22i171-193o)
PI (pH):   %s   6.07 (6.07) Peptide Signal:   %s   cut: 28 range:28-195
Sequence 236
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKGAYNMLLFVGCVVMLLMLSTQGSAEQHIVGGKQGWDQSTDFDTWASGQTFKVGDTLVFNYSPMHSVAELGSEDEYKKCDVGSAANSMSDGNSVVKLTKVGTRYFACGTAGHCDQGMKVKITTVSASSSGSSPSTPPSSSSSGSSPSTPPSSGSSPSTPTSTSTSTSGVIGVSGSFVFLASILGMSALMHILF

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGAAAGGTGCATATAACATGTTATTGTTCGTTGGTTGTGTCGTAATGTTGCTAATGTTATCGACACAAGGCTCAGCCGAGCAACATATTGTTGGAGGGAAACAAGGGTGGGACCAAT
CGACAGATTTTGACACTTGGGCGTCGGGTCAAACTTTTAAGGTCGGCGACACACTTG
GTAAGCTAAAGTATCTTTGGTATTAAACCATTCGCAATGGATTGTTCTCTTAATTTTCCATAG
TAGTTGTTACGTCAATTTAATTGCGTAGAAGTGGTGTTCAACGAATCAAAATTCAAGTCACTCGGTTAATAGGATTGAGTTATATGATTTTTTTTTTATTTCGAATTTGGACTTCGGGTT
GGTTGGATACGATTTGAATTTAAAGAAAAAAAAATTAACTCCATTATAAAACTATTGAATTTCTTTTAACATAAAAAATACAAGGTACACCAAAATATCATATTACCAAAATCTAAATTG
TTCAATATTAGGGTTCACACTTCTAGAGTTCCCATCATTTTTCATGAATGGCTGATATTGATGTTAGATTTAGGTGTTTGCTAATTGGGTCAGATACATGGAATTGGGTATTTGGATGTT
AGAATATTTTTGAAACTGGGTAATTGCTAATTGGTTTGGGCCGTTCTTTATTCTATTCAATTCACCAGCCCAAGTCCCAAAGTTAAAAAAAAAAACGCAATTTTTATGTATATGTATCTA
TATAAAAATTAAAATTGTTTACTTAGATTTTGAATTTCGAATCGAATCGAATCGAAATTACAAATTTGAAACTAATTTTTTTTTTTTTGGGAAATGTGAGGTTCATTACCTAGCTGCGAA
ATTGCAACCAATAAGAAAATTACAATAGAGTGGCAATAAACAAGCAACAAGTTATCCCGCAAGCCTCTTTTTAATAACAAAACCATATAAGCAATAGGATGGTTTAAAAATGAAATTTGA
ATTCAATTCGAATTGAATTTTGAATTCCTCTTTTGTATAGGATGAAAATAGGCAATAGTGTGGTTTGTTCTGGATGGTCTTTCTATAAAACGTTAGGTGACTTGAAAACGATACTTTTAT
GGCGTTATTTAATGGTTATCTTGTTTTTTTTTCTTTTTGGATAGTATTCAACTATAGTCCAATGCATAGCGTTGCGGAGCTTGGTAGCGAGGATGAATACAAGAAATGCGATGTGGGATC
GGCAGCGAATTCAATGAGCGATGGCAATAGTGTGGTGAAGTTAACAAAGGTTGGTACACGATACTTCGCATGTGGTACAGCTGGACATTGCGATCAGGGTATGAAGGTGAAGATTACTAC
GGTCTCGGCTTCTTCTTCAGGTTCATCACCATCCACACCACCTTCTTCTTCTTCTTCAGGTTCATCACCATCCACACCTCCTTCTTCAGGTTCATCACCATCCACACCGACTTCAACTTC
GACTTCAACCTCGGGTGTCATAGGTGTTTCGGGATCATTTGTATTTTTGGCTTCCATTTTGGGGATGAGCGCTTTAATGCACATCTTATTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGAAAGGTGCATATAACATGTTATTGTTCGTTGGTTGTGTCGTAATGTTGCTAATGTTATCGACACAAGGCTCAGCCGAGCAACATATTGTTGGAGGGAAACAAGGGTGGGACCAAT
CGACAGATTTTGACACTTGGGCGTCGGGTCAAACTTTTAAGGTCGGCGACACACTTG
TATTCAACTATAGTCCAATGCATAGCGTTGCGGAGCTTGGTAGCGAGGATGAATACAAGAAAT
GCGATGTGGGATCGGCAGCGAATTCAATGAGCGATGGCAATAGTGTGGTGAAGTTAACAAAGGTTGGTACACGATACTTCGCATGTGGTACAGCTGGACATTGCGATCAGGGTATGAAGG
TGAAGATTACTACGGTCTCGGCTTCTTCTTCAGGTTCATCACCATCCACACCACCTTCTTCTTCTTCTTCAGGTTCATCACCATCCACACCTCCTTCTTCAGGTTCATCACCATCCACAC
CGACTTCAACTTCGACTTCAACCTCGGGTGTCATAGGTGTTTCGGGATCATTTGTATTTTTGGCTTCCATTTTGGGGATGAGCGCTTTAATGCACATCTTATTT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTATAC ATTTGGTACA ACTTTGTAGT ATATATACAT ACCATGTTTG GTTGGTTCCA TACACAAATC ATTCAGTCAA ACAAAAATGG AGAAAGGTGC ATATAACATG TTATTGTTCG  TTGGTTGTGT CGTAATGTTG CTAATGTTAT CGACACAAGG CTCAGCCGAG CAACATATTG TTGGAGGGAA ACAAGGGTGG GACCAATCGA CAGATTTTGA CACTTGGGCG TCGGGTCAAA  CTTTTAAGGT CGGCGACACA CTTGTATTCA ACTATAGTCC AATGCATAGC GTTGCGGAGC TTGGTAGCGA GGATGAATAC AAGAAATGCG ATGTGGGATC GGCAGCGAAT TCAATGAGCG  ATGGCAATAG TGTGGTGAAG TTAACAAAGG TTGGTACACG ATACTTCGCA TGTGGTACAG CTGGACATTG CGATCAGGGT ATGAAGGTGA AGATTACTAC GGTCTCGGCT TCTTCTTCAG  GTTCATCACC ATCCACACCA CCTTCTTCTT CTTCTTCAGG TTCATCACCA TCCACACCTC CTTCTTCAGG TTCATCACCA TCCACACCGA CTTCAACTTC GACTTCAACC TCGGGTGTCA  TAGGTGTTTC GGGATCATTT GTATTTTTGG CTTCCATTTT GGGGATGAGC GCTTTAATGC ACATCTTATT TTAAAGAGAA AAACATATGG ATATGATATG ATGATCACCC TGTTTGTTTT  GATGCCTAAT CAATATTGTT TATTGTGTAG CCGTTGAGGA ATAGAATAAA ATTTGTTTAA ATGGTAACAT TTCGAACCAA TGTTATCTGA GTAAACTACC CGTACAAATA ACTTAAACGT 
ACTAAACGTA TGAATATCAT GAAAAAGA 

Retrieve as FASTA