Entry information : HaPNC07 (HanXRQChr11g0339131)
Entry ID 13725
Creation 2016-05-13 (Christophe Dunand)
Last sequence changes 2016-05-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaPNC07 (HanXRQChr11g0339131)
Name (synonym) HaPNC07 (HanXRQChr11g0339131)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC07
start..stop
S start..stop
HaPNC11 206 2e-70 1..112 1..111
HaPNC22 202 3e-69 1..112 1..111
HaPNC20 202 3e-69 1..112 1..111
HaPNC12 202 3e-69 1..112 1..111
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 100900374..100900551 178 N° 2 100900712..100900887 176  
join(100900374..100900551,100900712..100900887)


exon

Literature and cross-references HaPNC07 (HanXRQChr11g0339131)
DNA ref. HanXRQ genome:   HanXRQChr11 (100900374..100900887)
Protein sequence: HaPNC07 (HanXRQChr11g0339131)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   118 (89)
PWM (Da):   %s   12277.47 (9337.0) Transmb domain:   %s   i98-117o
PI (pH):   %s   10.24 (10.42) Peptide Signal:   %s   cut: 30 range:30-118
Sequence 159
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGSAMVSMAVLCLHVAALQCEIAQAATYAVGGNGGWTFNVSAGENGKKFKAGDILVFNYQKGAHNVVVVNKAGYVGCSTTPRNAKVYTSGKDKIRLVKVLTASFVVYLITVVLA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTAAGGGAAGAGGCAGTGCAATGGTGTCAATGGCTGTGCTATGTCTACACGTGGCGGCACTTCAATGCGAGATAGCTCAGGCAGCTACTTATGCCGTCGGCGGTAATGGTGGCTGGA
CGTTTAACGTCTCGGCTGGGGAAAATGGCAAGAAGTTTAAGGCCGGCGACATCCTTG
GTATCATCTCAACATCCTATCACTAGTTTACTTGCTTAGTTCTTTTTATAGGTAGCAATTTCA
ACCGATTTAGTTAACTTATTCTAAGTTCATTTAAAGTTTTAACAATAACAATAACAATAATAAAATGGTTACTTAAAATGATTTTTGATGGGGACAGTGTTCAACTACCAAAAAGGAGCA
CATAATGTGGTGGTTGTGAACAAGGCAGGGTATGTTGGGTGTAGCACTACCCCAAGAAATGCAAAGGTTTACACAAGTGGTAAAGATAAAATAAGGCTTGTAAAGGTCTTAACAGCTTCA
TTTGTAGTCTACCTGATCACTGTGGTGCTGGCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTAAGGGAAGAGGCAGTGCAATGGTGTCAATGGCTGTGCTATGTCTACACGTGGCGGCACTTCAATGCGAGATAGCTCAGGCAGCTACTTATGCCGTCGGCGGTAATGGTGGCTGGA
CGTTTAACGTCTCGGCTGGGGAAAATGGCAAGAAGTTTAAGGCCGGCGACATCCTTG
TGTTCAACTACCAAAAAGGAGCACATAATGTGGTGGTTGTGAACAAGGCAGGGTATGTTGGGT
GTAGCACTACCCCAAGAAATGCAAAGGTTTACACAAGTGGTAAAGATAAAATAAGGCTTGTAAAGGTCTTAACAGCTTCATTTGTAGTCTACCTGATCACTGTGGTGCTGGCA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCTATTGTT TAAGTGAACC ATGGCTAAGG GAAGAGGCAG TGCAATGGTG TCAATGGCTG TGCTATGTCT ACACGTGGCG GCACTTCAAT GCGAGATAGC TCAGGCAGCT ACTTATGCCG  TCGGCGGTAA TGGTGGCTGG ACGTTTAACG TCTCGGCTGG GGAAAATGGC AAGAAGTTTA AGGCCGGCGA CATCCTTGTG TTCAACTACC AAAAAGGAGC ACATAATGTG GTGGTTGTGA  ACAAGGCAGG GTATGTTGGG TGTAGCACTA CCCCAAGAAA TGCAAAGGTT TACACAAGTG GTAAAGATAA AATAAGGCTT GTAAAGGTCT TAACAGCTTC ATTTGTAGTC TACCTGATCA 
CTGTGGTGCT GGCATGA 

Retrieve as FASTA