Entry information : CsPrx57 (orange1.1g018811m/orange1.1t02046)
Entry ID 1373
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-07-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx57 (orange1.1g018811m/orange1.1t02046)
Name (synonym) CsPrx57 (orange1.1g018811m/orange1.1t02046)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue types Flowers
Fruits
Meristems
Vegetative tissues
Whole plant
Inducer Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx57
start..stop
S start..stop
CclPrx04 699 0 1..350 1..350
CclPrx68 522 0 1..349 1..348
CsPrx52 518 0 1..351 1..351
CclPrx05 517 0 1..350 1..350
Gene structure Fichier Exons


exon

Literature and cross-references CsPrx57 (orange1.1g018811m/orange1.1t02046)
Literature Close,T.J., Roose,M.L., Federici,C.F., Mu,L., Fenton,R.D., Wanamaker,S., Kim,H.R., Kudrna,D., Wing,R. and Yu,Y. Development of EST Resources and New Genetic Markers for California Citrus - Washington Navel Orange Shoot Meristem.
DNA ref. Citrus sinensis Annotation Project:   chrUn (32259351..32262331) Phytozome 12:   scaffold00043 (65565..68279)
Cluster/Prediction ref. UniGene:   Csi.5042
Protein sequence: CsPrx57 (orange1.1g018811m/orange1.1t02046)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (325)
PWM (Da):   %s   37410.33 (34616.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.31 (4.33) Peptide Signal:   %s   cut: 26 range:26-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPLRYLLAAAVLFAFVLDESSSQAQLTPDFYNTTCPNASNIILGVLQNAFNSDIRITASLIRLHFHDCFVNGCDGSILLDNVANDTSIDSEKFSMANNNSARGFEVVDAMKAALESACP
GIVSCADILAIASEQSVNLSGGPSWTVPLGRRDGRTANRSLADQNLPTPFQTLDLLKGRFTNVGLNDNTDLVALSGAHTFGRAQCQFFSQRLFNFNGTGNPDPTLNATLLAQLQQLCPQG
GNGSVLTNLDLSTPDGFDNDYFSNLQANNGLLQSDQELFSTPGADTIPIVNNFSSNETAFFESFAVSMIRMGNLSLLTGTQGEIRSNCRRVNANNLSTRSSSDGGLVSSI*

Retrieve as FASTA  
Remarks Complet cDNA sequence from genomic and 20 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST