Entry information : HaPNC22 (HanXRQChr17g0535631)
Entry ID 13730
Creation 2016-05-13 (Christophe Dunand)
Last sequence changes 2017-12-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-12-08 (Christophe Dunand)
Peroxidase information: HaPNC22 (HanXRQChr17g0535631)
Name (synonym) HaPNC22 (HanXRQChr17g0535631)
Class Plantacyanin    [Orthogroup: PNC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaPNC22
start..stop
S start..stop
HaPNC20 256 1.63e-90 1..125 1..125
HaPNC12 256 1.63e-90 1..125 1..125
HaPNC11 249 7.72e-88 1..125 1..125
HaPNC16 240 5.43e-84 1..125 1..125
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13730' 'complement(join(111221595..111221791,111221951..111222128))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 111221951..111222128 176 N° 2 111221595..111221791 195  
complement(join(111221595..111221791,111221951..111222128))


exon

Literature and cross-references HaPNC22 (HanXRQChr17g0535631)
DNA ref. HanXRQ genome:   HanXRQChr11 (111222128..111221595)
Protein sequence: HaPNC22 (HanXRQChr17g0535631)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   125 (96)
PWM (Da):   %s   13032.61 (10034.1)  
PI (pH):   %s   9.98 (10.33) Peptide Signal:   %s   cut: 30 range:30-125
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGRGSEMVSMAVLCLHVAALQCEIAQAATYAAGGNGGWTFNVS
GWENGKKFKAGDIL
VFNYQKGAHNVVVVNKAGYVGCSTTPRNAKIYTSGKDKIRLVKGLNSFICSLPGHCGAGMKIQIS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGAAATGGTGTCAATGGCTGTGCTATGTCTACACGTGGCGGCACTTCAATGCGAGATAGCTCAGGCAGCTACTTATGCCGCCGGCGGTAATGGTGGCTGG
ACGTTTAACGTCTCCGGCTGGGAAAATGGCAAGAAGTTTAAGGCCGGCGACATCCTTG
GTATCATCTCAACATCCTATCACTAGTTTACGTGCTTAGTTCTTTTTATAGGTAGCAATTTC
AACCGATTTAGTTAACTTATTCTAAGTTCATTTAAAGTTTTAACAATAACAATAACAATAATAAATGGTTACTTAAAATGATTTTTGATGGGGACAGTGTGTTCAACTACCAAAAAGGAG
CACATAATGTGGTGGTTGTGAACAAGGCAGGGTATGTTGGGTGTAGCACTACCCCAAGAAATGCAAAGATTTACACAAGTGGTAAAGATAAAATAAGGCTTGTAAAAGGTCTTAACAGCT
TCATTTGTAGTCTACCTGGTCACTGTGGTGCTGGCATGAAGATTCAAATCTCTGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGGGAAGAGGCAGTGAAATGGTGTCAATGGCTGTGCTATGTCTACACGTGGCGGCACTTCAATGCGAGATAGCTCAGGCAGCTACTTATGCCGCCGGCGGTAATGGTGGCTGG
ACGTTTAACGTCTCCGGCTGGGAAAATGGCAAGAAGTTTAAGGCCGGCGACATCCTTG
TGTTCAACTACCAAAAAGGAGCACATAATGTGGTGGTTGTGAACAAGGCAGGGTATGTTGGG
TGTAGCACTACCCCAAGAAATGCAAAGATTTACACAAGTGGTAAAGATAAAATAAGGCTTGTAAAAGGTCTTAACAGCTTCATTTGTAGTCTACCTGGTCACTGTGGTGCTGGCATGAAG
ATTCAAATCTCTGCT

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGG GAAGAGGCAG TGAAATGGTG TCAATGGCTG TGCTATGTCT ACACGTGGCG GCACTTCAAT GCGAGATAGC TCAGGCAGCT ACTTATGCCG CCGGCGGTAA TGGTGGCTGG  ACGTTTAACG TCTCCGGCTG GGAAAATGGC AAGAAGTTTA AGGCCGGCGA CATCCTTGTG TTCAACTACC AAAAAGGAGC ACATAATGTG GTGGTTGTGA ACAAGGCAGG GTATGTTGGG  TGTAGCACTA CCCCAAGAAA TGCAAAGATT TACACAAGTG GTAAAGATAA AATAAGGCTT GTAAAAGGTC TTAACAGCTT CATTTGTAGT CTACCTGGTC ACTGTGGTGC TGGCATGAAG 
ATTCAAATCT CTGCTTGA 

Retrieve as FASTA