1. Browse the Database
  2. View Redoxidase
Entry information : AtCSD02 (AT2G28190/CSD2/CZSOD2)
Entry ID 13733
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2016-06-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: AtCSD02 (AT2G28190/CSD2/CZSOD2)
Name (synonym) AtCSD02 (AT2G28190/CSD2/CZSOD2)
Class Cu/Zn SOD    [Orthogroup: CSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtCSD02
start..stop		 S start..stop
TsCSD02 349 5.92e-124 3..216 2..226
NoffCSD02-1B 339 1.52e-120 3..216 2..207
NoffCSD02-1A 324 2.1e-114 31..216 34..215
HaCSD04 311 3.11e-109 8..216 14..225
Gene structure Fichier Exons►


exon

Literature and cross-references AtCSD02 (AT2G28190/CSD2/CZSOD2)
Omic ref. AtProteome:   At2g28190 ATTED-II:   At2g28190 e-FP Browser:   At2g28190 ePlant:   At2g28190 TAIR:   At2g28190
Protein sequence: AtCSD02 (AT2G28190/CSD2/CZSOD2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   216
PWM (Da):   %s   22230.32  
PI (pH):   %s   7.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATNTILAFSSPSRLLIPPSSNPSTLRSSFRGVSLNNNNLHRLQSVSFAVKAPSKALTVVSAAKKAVAVLKGTSDVEGVVTLTQDDSGPTTVNVRITGLTPGPHGFHLHEFGDTTNGCI
STGPHFNPNNMTHGAPEDECRHAGDLGNINANADGVAETTIVDNQIPLTGPNSVVGRAFVVHELKDDLGKGGHELSLTTGNAGGRLACGVIGLTPL*

Retrieve as FASTA  
Remarks
DNA ►
Send to BLAST
CDS►
Send to BLAST