1. Browse the Database
  2. View Redoxidase
Entry information : HaFSD02(HanXRQChr08g0223321)
Entry ID 13745
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2017-12-08 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-05-19 (Christophe Dunand)
Peroxidase information: HaFSD02(HanXRQChr08g0223321)
Name HaFSD02(HanXRQChr08g0223321)
Class FeSOD    [Orthogroup: FSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaFSD02
start..stop		 S start..stop
HaFSD03 340 3.72e-120 2..199 50..255
HaFSD01 296 3.72e-102 2..200 50..271
LeFSD03 286 5.73e-99 2..194 49..249
LeFSD02 283 4.28e-97 2..189 49..259
Gene structure Fichier Exons►


exon

Literature and cross-references HaFSD02(HanXRQChr08g0223321)
DNA ref. HanXRQ genome:   HanXRQChr08 (59089056..59081500)
EST ref. GenBank:   CD847604.1
Protein sequence: HaFSD02(HanXRQChr08g0223321)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   204
PWM (Da):   %s   22882.71  
PI (pH):   %s   5.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIDLKPPPYALDALEPHMSKETLEYHWGKHHRGYVNNLNKQIEGTELHEKSLESIILASYNKGDILPAFNNAAQVWNHEFFWESMKPGGGGKPSGELLELIIRDFGSFEALIQEFKLGAA
THFGSGWTWLVYDIEHKKLAVLKTSNAINPLVLDYYPLLTLDVWENLRPDYIATFLDKLVSWDAASSRLDAAKVSIEGKKDGG

Retrieve as FASTA  
Remarks Complete sequence from genomic and EST. Shorter 5' but confirmed with EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST