Entry information : HaFSD04 (HanXRQChr17g0541091)
Entry ID 13750
Creation 2016-05-24 (Christophe Dunand)
Last sequence changes 2016-05-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-11-23 (Catherine Mathe (Scipio))
Peroxidase information: HaFSD04 (HanXRQChr17g0541091)
Name (synonym) HaFSD04 (HanXRQChr17g0541091)
Class FeSOD    [Orthogroup: FSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Helianthus
Organism Helianthus annuus (Sunflower)    [TaxId: 4232 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HaFSD04
start..stop
S start..stop
LeFSD01 378 1.04e-133 70..292 30..252
TsFSD03 377 3.79e-133 58..292 29..263
NoffFSD03-1A 375 1.22e-132 58..292 29..263
ThasFSD03 373 1.23e-131 58..292 30..264
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13750' 'complement(join(25460772..25460894,25461022..25461045,25461904..25461930,25462023..25462096,25462338..25462509,25464064..25464255,25464385..25464474,25464571..25464660,25466245..25466328))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25466245..25466328 82 N° 2 25464571..25464660 88 N° 3 25464385..25464474 88 N° 4 25464064..25464255 190
N° 5 25462338..25462509 170 N° 6 25462023..25462096 72 N° 7 25461904..25461930 25 N° 8 25461022..25461045 22
N° 9 25460772..25460894 121  
complement(join(25460772..25460894,25461022..25461045,25461904..25461930,2546202 3..25462096,25462338..25462509,25464064..25464255,25464385..25464474,25464571..2 5464660,25466245..25466328))


exon

Literature and cross-references HaFSD04 (HanXRQChr17g0541091)
DNA ref. HanXRQ genome:   HanXRQChr17 (25466328..25460772)
Protein sequence: HaFSD04 (HanXRQChr17g0541091)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   292
PWM (Da):   %s   33519.79  
PI (pH):   %s   7.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSWSSSNYLCLSSSSSVTQFSRCKLPCESEGQRGKCQDLNRATNISAYNSLKPPSFKLDKGQRRNDHVLKKPRNISAYYSLKPPPYKFDALEPYMSKRTLEVHWGEHHRGYVESLNKYLG
KDDILYGYTLDELIRVTYNNGNPLPEYNVAAQ
VWNHDFFWESMQPGGGNLPILGLLEQIEKDFGSFSNFREEFIETALTLFGSGWVWLVLKRNEKRLAIATTTNAVTPLVWDDPLLSLDM
WE
HSYYLDYKNDKARYVNVFMDHLVSWNAALARMARAQSFVNLGEPKIPVA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGGTCCAGTAGTAACTATCTTTGCTTGTCAAGCTCAAGCTCTGTTACACAGTTTAGCAGGTGCAAGTTGCCTTGTGAGGTGAGGTTTTAGTGTTCATGGAATTGCTTGTTTGTT
ATTTGAATGTTCCTTATCTCTTGAAGTTGTTGTAGAAGTATGTCTTTAATCCAATTTGGAATCATTTTCTAAAGGACTGAAGTTTTCCTTTGTGTTTGATGTTACTGAATGAGGAACTAA
GCAGTTAATGCGGTAAAAAAACTGATATCGGTCAAGGACCGATATTTGAGATATCGGTTCTCGCGGTGGGATATCAGTAATTTTAATATCATGCTGAGTTTATTTTATATATATATATAT
ATATAGCAATTTGACACTAACAGTTCAGTATATTTTCTTACCATTAAGAAATTAACCTTTTGCAACTTGCAAAACACTACAACTGTAGTAAGTAGGAACTGATTAAGACTTAAAACACTA
ACATTTAACACTAACAATTAGCAATTAAGACTTAAAATTCCAATAGGGGTTAATAAGAAGAAAGACGAATGACTAAAAAGAAAGGTACTGATCTCGGGAAAATCGATGATATATCGGTCA
ATATCGCTGATAAGATCGGTACCGATATTCTGACCGATATTTTGCACCGATATCTCACCAAAGGACCGATAACCAATATATCACCGATATATAGGTGATATATCGCGATATTAACTCATA
GATGAGGAATAAACTCATTTTGCAAGAAATAAACAAATTCTAGGAAGTGTTGAACATAGATATCTAGGTATTTGAGTTTCATATCAAGTTATTTCTCACAATCCCAATGCTTTTAGGTGG
TGTTTGGTAAGCTTATTGTAGCCTTTTAGAGAAGCTCCATCCTAAAACTTAAATGATATTAATAACTTTTATTATAATGCATTAAACGAGTTAGCTCCTTTAATAAGCTATAACCCAAAC
ACCCCCTTAATAAGATGGCATCTATTAGTGTGTTTCTTAACAGTGTTCATCTCCATCATGCAGTCATGATAGAGATTTGGCTAGTTTTTGGAAATGTACACTCCTGTATAGTTTCTGAAA
ATGCTTATTATACTGAATGTCTGAATTCAAGTTTCGTTTGAGCAATGTTTGAGGAGCAATATCATCTGTAGTTACTAATTAGGATCTTGGTTTTAAAAAGCGAGAGGCGCACAAAAGCGA
CGAGGTCTAAAAATGAGGCGCGAAGCGCAAAGCGCAAAAGCGGTGGGCTTTTTGTACCCGAGGCGCAAGAAGATTATATAAATTTTTATATATATCCCATAGGTTTTTAGCATCCCTTAT
CCAAAATATAGGTATAGCTAAGGTTTATATATGATTTGATCTACATGTACAAGCCAAAAAACCTATTGTCCAACACTTTCATGCATAAAAACAACATAAAAACACCCAAAATACATAAGG
AGCGCGCCTCAGACCTCAAAAAACCCAAAAAAAATGCGCTTTTCTTGCGCTTTTTGGAAAAAGTGCGCCTCAGGTACCCTGAGGCGCTGATACCTGCGCCTTAGTGCGCCTCGCGCCTAG
GCGCCCCTCAGGCACGCTTTTTAAAACCCAGATTAGGATGCCATTTTGGTTACCTGGTCATGTATACCGGTTATTGTAATAACATTTAATGATCGTTTGACATGGCAGTCTCTGAAGGGC
AACGCGGGAAATGTCAAGATCTAAATAGGGCAACAAACATTTCTGCTTACAACAGCTTGAAACCTCCGTCTTTTAAACTC
GTAAGTTTATGTAATATCACCAAATACTTTGTTTAGTTAT
TCTGATCAACTTTACTTAATGTATTCTATCAGTCTTATCGGTTTATGACATGTCAGGAGATAAGGGTCAAAGAAGGAACGATCACGTCTTGAAAAAGCCAAGAAACATTTCTGCTTACTA
CAGCTTGAAACCTCCACCTTATAAATTT
GTAAGCCTCGTTACCATCTTCCTATTTGAGTACTGCCACATGCTGAATCAAGCGAATGGGAAAAAAACAAGTATTATCATTTTAGCTGTTGA
ACAGATATTGATTTTGTCTTCTGTTTTTTTTTTTCAGGAGATGCCCTAGAGCCGTATATGAGCAAAAGAACGCTTGAGGTCCACTGGGGAGAACATCACCGTGGTTATGTGGAAAGTTTG
AACAAATATTTAGGAAAGGATGATATATTATACGGATACACATTGGATGAATTGATCAGAGTCACATATAACAACGGAAACCCTCTGCCAGAATATAACGTTGCTGCTCAG
GTTTGAACA
ATTCATTAGTTACCAGTCTTTGAAACCTAGAATTAGCATGAGATCATTGCAGAATGAGCCACTGGTTCATATTAGATGATAGTGATAAATATCAAGAAACCATTCCTGCTTTTAGTCTAC
CAAGAAATCAAGATTTGACGTGCATTTTAGTGGATTTCATAGTATAAGGGTGGAGTACTTTGTAAAAAATATAATAAGTTAATCTAACTTAAATATATATAATTAGTATCATAATATTGG
TATCTTAATTTTAAAAAGCGATAGGCGCACAAAAGCGACGAGGTCTAAAATTGAGGCGCGAAGCGTAAAGCGCAGAAGCGGTGGGCTTTTCGTACCCGAGGCGCAAGGTGTTTATATAAT
TTTTTTATATATCCCATACATATCCCGTAAGTTTTTAGCTTCTTTTAACCAAAATATGATATAAATAAGGCTTTTATATCATTTTATTTACATGTACAAGTCAAAAAACCCAAGGTACAA
CATTTTTCTGCAGAAAAACGCCTCAGATACATGAGGCGCGCGCCTCAGGCCAAGAAGCCCCCCAAAAAACCCAAAAATCTGCGCCTTTTGGGCGCTTCTTGTAATTACACAAGGCGCTGA
GCGAAAAAGGACCAGAGCTGCGCCTTAGTGCGCTCGCCCTCAGGCGCGCTTTTTAAAACCAAGATTGGTATTTTCTTTATATTTATTCATAACACAAATACACAATTATTCATAACACAA
TCCGTTAGAGTTTAATTATTAAAACATTAATAACCAAACCCAGTAAATCCCACAAATAGCAAAACTATCTATCTCTAAAATTATACTAAACAAAATTCATTGAGAAAAGAATTAGTGAAT
GGAAAAGAGTATACCACTATCTTATACACTTGAGAGTATTATCTCATTAAAACTATGACAATAAGGCTGGAGGGTGTGGGATAAATCCCCTAGGGGCTTTATCACGCCACGTCAGCTCCA
CGTCAGCCAGGGGGCTTTATCACGCCTTCTCTTAACTTGCAGGGTGTGGGATAAAGCCCCCCTATTAAACAAAATAAAAAAAAAAAAAAGATTTCATTGGTTGAAAAGAGGTGGGCCCCA
CCTGCACCCCCCCTCCTTCCGTTAACACAATGGCGAGAGACCCATGGCGCCCCCTGTTAATTTGCTCGGTATGGGCGGTGGCGCCCCGGGGGCGCTATAGGTGGTGAGGTGACAGGGGTG
GCGCCCTCCATAGCCTCCGGCCTAAGAGATCCCAACACAAAGGCTATTTGAAAAAATCTTAAATCAACTAGTCAAGATTTTGAAAAAAAAATTAGTGATAATTTGATTTATGTCGTTTAA
TTGCCTATTCTAAAATCATAGTTTTCGATTTTTTAATAGAATTAATAACCTTAAAATTGGTTCCACGTGAATCTATATATAACCTGAATTTAATAACTTTATTTTTATCTTATATGAAAA
GGCCCAATTTAAGTTATGATTCCTTGTTCTTTAGAGATCAAAAAGATGTTTTTTTTTTCTTTTTTTTTTTTTAATAAAATTCATATCGATATTGTACGTTTTCAGGTGTCTGGAATCATG
ATTTCTTCTGGGAATCCATGCAACCAGGAGGTGGTAATTTACCGATATTGGGTCTACTTGAGCAGATTGAAAAGGATTTTGGTTCCTTTTCAAATTTTAGAGAAGAGTTTATTGAAACCG
CACTCACACTATTTGGCTCTGGATGGGTTTGGCTTGTTT
GTATGTCTCCTGTCACTTGCTTGATTCTTTCATCATATATTTTTTTTATAAAATCTAGGAAATATTATATCTTTTGATGAA
TTCCATATAGTTTTCAAAATCAGGAAAAATATGTTTATGTAATTGAGAAGAAATGTGATTTTGTTATTGTAATGGATTGTGCATATTCATATTATCTGATTTTTGTGTGGTGTGGCTCGG
TTACATTTGTTGATTTCTGTGTATTTTTTTTTTGTTTCAGTATAAAGCGGAATGAAAAACGACTTGCAATAGCTACAACGACAAATGCTGTAACCCCACTCGTTTGGGATGATATTGTAA
GCAAGCTTCTCGTATTGTTACTATTCTTATTATGTGAATATCTTTTTTTTCCTTTTACCAATGCGTTATTCTCTTTCTGCTTTCACAGCCCCTCTTCTTAGTTTGGATATGTGGGAGGTA
TTACTCTCTCTCTCTCTCTCTCGATGAAATTACTATTTTATTCAAATATCTAAAACGATCCTTAAATGATGGCAAAGGAGATTAACTGTATATATCAATATCAATTTCAAGAGTGTTCTA
ATTAGGTCACTCATAATTTTTTTTTTTGTTCTAATTGGGTCATTCAAGTTTCATTTGATGTTTCAATCCTAGATATTTTACCTAAATAGAAGGTCATCCATCCTACATGGCATTTATATA
GGTTTTTTATTTAAAAAAATTGTTGACATGGCACATAAATGCCAAATGGATTAGAAAAAAATGCGAAATAGGTTTAAAATATTTTTTTTAATTGTAGAAAAGTTAAAAAAATGCGAAAAA
AATTAAAAAATGTGAATTTTTTTTCAAAAAATCTAAAAAGTTATAAATGAAGATAAACAACTAACGATAAAATTTCAACGATTTGTAATATTTGATCCTTTTGGGTTTTGATTTTGTTTT
GATTTATTATATTTCTTTTTTTATTCCATGTCATCATGTTTTTTTTTAAAAGTTAAATAAATGCCATGTAGGACTATGACCTTCTATTCAGGTAAAATCTCTAGCATTAGAACACCAAAA
TAAAGTAGACTGATCTAATTGGAACAATAAATTTTATCAGTGACCTAATTGGAACACTCCTAAAACTTCATTACTATTTTGTGGCATATTCCCTATTTTTTAACGAATCTAAACAAACAA
GTATTCTTTCATTTCAGTTGTTTTGAAATATTGTAATTTACTTTGAGATGTCTTAGTTTCTGGCATTCTTTTTTGGGTGGACTGTGTGTATTGGATTGATTATTCATTCTCATTTTCCTT
TATTTTGTTTTGCAGCACATTCTTATTATCTGGATTACAAGGTATTATTTATATCAAACGCTCTTCTATAGTTCTATTCGCAGCCAATTGCTTAATATCTGTTTTACACATCTAGTTTCG
TATTTAACTTGACCATATTTTTCTGTTCTCTCTCTTTTTTTTCAACAGAAAACGACAAAGCGCGGTATGTTAATGTCTTCATGGATCATCTTGTGTCATGGAATGCGGCATTGGCTCGAA
TGGCACGTGCACAATCCTTTGTAAATTTAGGAGAACCGAAGATTCCGGTTGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTGGTCCAGTAGTAACTATCTTTGCTTGTCAAGCTCAAGCTCTGTTACACAGTTTAGCAGGTGCAAGTTGCCTTGTGAGTCTGAAGGGCAACGCGGGAAATGTCAAGATCTAAAT
AGGGCAACAAACATTTCTGCTTACAACAGCTTGAAACCTCCGTCTTTTAAACTC
GATAAGGGTCAAAGAAGGAACGATCACGTCTTGAAAAAGCCAAGAAACATTTCTGCTTACTACAGC
TTGAAACCTCCACCTTATAAATTT
GATGCCCTAGAGCCGTATATGAGCAAAAGAACGCTTGAGGTCCACTGGGGAGAACATCACCGTGGTTATGTGGAAAGTTTGAACAAATATTTAGGA
AAGGATGATATATTATACGGATACACATTGGATGAATTGATCAGAGTCACATATAACAACGGAAACCCTCTGCCAGAATATAACGTTGCTGCTCAG
GTCTGGAATCATGATTTCTTCTGG
GAATCCATGCAACCAGGAGGTGGTAATTTACCGATATTGGGTCTACTTGAGCAGATTGAAAAGGATTTTGGTTCCTTTTCAAATTTTAGAGAAGAGTTTATTGAAACCGCACTCACACTA
TTTGGCTCTGGATGGGTTTGGCTTGTTT
TAAAGCGGAATGAAAAACGACTTGCAATAGCTACAACGACAAATGCTGTAACCCCACTCGTTTGGGATGATATTCCTCTTCTTAGTTTGGAT
ATGTGGGAG
CATTCTTATTATCTGGATTACAAGAACGACAAAGCGCGGTATGTTAATGTCTTCATGGATCATCTTGTGTCATGGAATGCGGCATTGGCTCGAATGGCACGTGCACAATCC
TTTGTAAATTTAGGAGAACCGAAGATTCCGGTTGCC

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTTTCTTC CATTAAAACG ATGATTGTTG TGGGTCGGAT AAGATTCACC ATCGAACCGT GCCCTAACTC AAGAGAACCA CCATCTACTC GAAAGGTGAC CATAGTACGA GGAAAGCCAA  CATACCGATA AGGATCAAGA ACATCAACGT CTCTCAACCT TGTACTATCG ATACAGAGCA GAACAGAGAA ACCCCATTAA GGTGTCTTTT TTTGAGGTGC CAGAAAGGGG TGTTTAGTAG  ATATGAGTTG GTCCAGTAGT AACTATCTTT GCTTGTCAAG CTCAAGCTCT GTTACACAGT TTAGCAGGTG CAAGTTGCCT TGTGAGTCTG AAGGGCAACG CGGGAAATGT CAAGATCTAA  ATAGGGCAAC AAACATTTCT GCTTACAACA GCTTGAAACC TCCGTCTTTT AAACTCGATA AGGGTCAAAG AAGGAACGAT CACGTCTTGA AAAAGCCAAG AAACATTTCT GCTTACTACA  GCTTGAAACC TCCACCTTAT AAATTTGATG CCCTAGAGCC GTATATGAGC AAAAGAACGC TTGAGGTCCA CTGGGGAGAA CATCACCGTG GTTATGTGGA AAGTTTGAAC AAATATTTAG  GAAAGGATGA TATATTATAC GGATACACAT TGGATGAATT GATCAGAGTC ACATATAACA ACGGAAACCC TCTGCCAGAA TATAACGTTG CTGCTCAGGT CTGGAATCAT GATTTCTTCT  GGGAATCCAT GCAACCAGGA GGTGGTAATT TACCGATATT GGGTCTACTT GAGCAGATTG AAAAGGATTT TGGTTCCTTT TCAAATTTTA GAGAAGAGTT TATTGAAACC GCACTCACAC  TATTTGGCTC TGGATGGGTT TGGCTTGTTT TAAAGCGGAA TGAAAAACGA CTTGCAATAG CTACAACGAC AAATGCTGTA ACCCCACTCG TTTGGGATGA TATTCCTCTT CTTAGTTTGG  ATATGTGGGA GCATTCTTAT TATCTGGATT ACAAGAACGA CAAAGCGCGG TATGTTAATG TCTTCATGGA TCATCTTGTG TCATGGAATG CGGCATTGGC TCGAATGGCA CGTGCACAAT  CCTTTGTAAA TTTAGGAGAA CCGAAGATTC CGGTTGCCTA ATAATTATGT CTCTTGTTTA GATAGCAAGT TTTGCAGGTA GTAATGCAAC CATTATTTGG AAAAATGTAT GCTTAAGCAT  TTAACTTTTG TGGCTGTTGA AAATTTCAGT TGCTTTTGTA GTTCTGCAAA CTCTCCACTT CACTAATGAC CAGGGACTAG ATATCCGATC ATTCAAATCA ACAGAACAAA CACAATCACC  AAAAACATTT GATTTTACAA TCACATACCC TTCATTTTCA CTAATCCTTA CATAATCCAA AAGCATTGGG GATAATAACA AAGTCATTAT TATTTCTAAA GTCTGTTCCT TCTAAATAAC  TAGAATTGAT TCCCCGCGTT GCGGGGTCAG TTTTTTTAAT GTGACTTGAG CGTACTGAAT GTTTTTGCAA TTGCTTATCA ATCATAACGT AAATAACTTG AATTTATACC GGCTCGCATA 
TAAAAATAAA CACATAAAAC TCGAATGAGT CAA 

Retrieve as FASTA