Entry information : CsPrx04 (orange1.1g045164m/Cs1g18600)
Entry ID 1379
Creation 2005-06-22 (Christophe Dunand)
Last sequence changes 2017-11-30 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-12-01 (Qiang Li)
Peroxidase information: CsPrx04 (orange1.1g045164m/Cs1g18600)
Name (synonym) CsPrx04 (orange1.1g045164m/Cs1g18600)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue types Seedlings
Whole seedlings
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx04
start..stop
S start..stop
CclPrx94 683 0 1..334 1..335
PtPrx08 536 0 5..329 7..331
CsPrx36 530 0 23..327 25..329
CclPrx33 528 0 23..327 25..329
Gene structure Fichier Exons


exon

Literature and cross-references CsPrx04 (orange1.1g045164m/Cs1g18600)
Literature Bausher,M., Shatters,R., Chaparro,J., Dang,P., Hunter,W. and Niedz,R. An expressed sequence tag (EST) set from Citrus sinensis L. Osbeck whole seedlings and the implications of further perennial source investigations. Plant Sci. 165, 415-422 (2003).
DNA ref. Citrus sinensis Annotation Project:   chr1 (21579525..21581281) Phytozome 12:   scaffold00074 (51756..50031)
EST ref. GenBank:   CF653161
Protein sequence: CsPrx04 (orange1.1g045164m/Cs1g18600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (305)
PWM (Da):   %s   37566.78 (33984.0) Transmb domain:   %s   i7-26o (i7-26o)
PI (pH):   %s   6.67 (6.17) Peptide Signal:   %s   cut: 30 range:30-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATKRHHHLCSSYFFLLLPLLLQFYSGESQLQFNYYAESCPKAEDIIKQQVINLYNKHGNTAVSWVRNLFHDCIVKSCDASLLLKKAGGIVSEQASERSFGMRNFRYVDTIKEALEEECP
VTVSCADIVALSAREGIVMLGGPRIEMKTGRRDSKESYFTEVDKLIPNHNDSLSTVLSAFQSTGIDVEGTVALLGAHSVGRVHCVNLVHRLYPTVDPSLNPEYGEYLKRRCPTPNPDPKA
VLYARNDPETPMIIDNNYYKNLLNQKGLLIVDQQLASDPRTAPFVEKMAADNGYFHQQFSRAVGLLSENNPLTEDQGEIRKDCRYANSNTNNVY*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 2 ESTs (CF653161 and CK701406).
DNA
Send to BLAST
CDS
Send to BLAST