Entry information : Pret2CysPrx01
Entry ID 13798
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-23 (Harold Duruflé)
Sequence status complete
Reviewer Harold Duruflé
Last annotation changes 2016-06-23 (Harold Duruflé)
Peroxidase information: Pret2CysPrx01
Name Pret2CysPrx01
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pret2CysPrx01
start..stop
S start..stop
Dr2CysPrx01-2 360 4e-129 1..198 1..198
Cfa2CysPrx01 353 2e-126 1..198 1..198
Ptro2CysPrx01-1 352 4e-126 1..198 1..198
Hs2CysPrx01 352 4e-126 1..198 1..198
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..106 106 N° 2 241..394 154 N° 3 477..599 123 N° 4 819..949 131
N° 5 1067..1149 83  
join(1..106,241..394,477..599,819..949,1067..1149)


exon

Literature and cross-references Pret2CysPrx01
Cluster/Prediction ref. Genebank:   103479005
Protein sequence: Pret2CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   198
PWM (Da):   %s   21911.22  
PI (pH):   %s   6.27
Sequence 239
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAGNAKIGKLAPDFLAKAVMPDGQFQDLKLSDYRGKYVVFFFYPLDFTFVCPTEIIAFSDAAEEFRKIGCEVIAASVDSHFSHFAWTNTPRKQGGLGAMKIPLVSDTRRTISTDYGVLKEDEGIAYRGLFIIDDKGILRQITINDLPVGRSVEETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKDFFSKQ

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTAGAAAAAA ATGACTTAAA AAAAAGAACA CAATTTACAT ATGGAATTTC TCCTCGCATC CACTTACGGT GCTAGTAAGT TCTTAGGCCT TACTTTGACA GGATTAAACA TAATCTGTTA  CTCTGTGTTA AATAGCCTAG TTTTTGTCTC ATATGAAACA TGGCTGCTTT GTGAACTCAA ACAAGATCTT TTGTATGAAG TGCAGATTTT GAAGGAAATT CAATGAAGGT ATATACCATA  AAATACAGAT TGTTTTTATT GCTGGTTCAT GGTGATAAGG ATGTACTCTG AATTGGGTTG AGTTACGTGG CAACCAACCT CTTGACTCAA AGACCCTTTC CTGGTTTCTT TGCGGAAGAA  TGAACCTCGA AAAAAAAATA CGTCTTATGT TTTGGATAAT TATGTCAATA AATATATTTT CGAAAGCGAC TCGTAAGAAT AGACAAATTG CATAAAACGG TTATTTAACA CTTCTTCTGA  AGGTTTCCTC GACGTTTTCC TTCGAGTAAC TTACATTCCC AGAAAGGGGG AGGTTTGGAA AGTGCAAAGT CATGCTACAT TGTGGCGTGG TCAGGACTGG AGAAGTGAAC TGAGGAGATG  CGTCTCGTTG TTTGGTAAAA GTATCGCGAG ATTTTGGTGA AGGTATATAA ATCCAGTCGA CAAAGCCAGC CGCTGCACTC TACGGTTGTG GATGCGAGGA GAAATTTTAC AAAAGGTAGG  TGTTTAAAAA AAAAGAAAGA AAAGAAAGAA AAGAAAATGA CAACTTTTCT CTATATATGT GTTGTTTTGG AGTAGTGTTT TTTGTTTTAA ACTTCCAATT CGCGGGGCTT AAAGATCAGG  GCGTTCTCAT TCGTGTTTTT GAAGCATTCA ACAAGTGTTT TCCTCTTTTT TTAAAATCAG AAAACGGGAC GGTCGTCTGT AAATCCAGTG TGACAAGAGT TGGCTTAATC AGTATTTTCT  GTCCGACATT GAAGTATTTA TCTGAAATCG GGTTTTCTTT TTAGTCATTT TTGAATGTAC TTCCGTTAAC CAGGTAAATA CCTACATTTC TGTTCGTAAA GGGTTGTTTT TCATAAGCGC  CACGCGCTCG TCGACGAAAG CACGATGGGA AAAAATAAGT TTTATTTATT CATATACGGA AACACCTGTG AAAGAAGAGA AGTGGTCATG GGATATGTTT CGAAAGATCC CAACTGACTG  CTGCTTTCTG TGCATAACAG CCCGAGTAAT TTATTGTAAG ATATTATGCG CAATTACCTT GTCTGAGGCT TTTGGCTCTC GGTGAATGAT CAGATTTGAT GCTGCGCAAT ATAATTATGT  CAATATACAT TTAGATTTCT CAAATCTGTT AGCATTTTTC GCACATTAAA TTGAGTTCAA ATTAAAAAAT ACTTAATTAA CCCCAAAGGG AAATGTAATG AGGTACCTAA AGTCAGGTGT  GAGAATGGCT GACATGAACA TTTGCAAATA ACTGTCGTTG TGTTCAACAA GCAGAAAAGT CTGGAATTTA ATTTAATTAT TTTTCACATG TAGAAGAAAT ACGGAGCAAG AAACAGGATG  TATTGCTTTG TATTATCAGC ATTTCCTCCA CTCATGCTTT ACAGATTCTG TCTAACCTCA GTAAAATAAT CAAGTAGGAT TTTGTTTATA GTTGAAAGTG AACAAGAAAA AAAAACTTTG  AATACTATTT GAAATGTTTT TTTTTTTTTT TTTTAATCTT TGAGAACATA AATAATTTTT CATCTGGAAC TGTATTGAAA ATGTGTATGA AGTGGAACCC TGAAAAATGT AATGAAATAA  AAATATTTAA CATTAGTGTA GCCATGTGAA CAATTTCCCA GACTTAAATT GTAAACAAAA ATTATTTTTA TTGCATGAGT TGCGCAAGTG GGCTCATATT TATATTAGAC ATTCCTTTTA 
TAAAATAAAC AATAGGCAGC TGTAAGTTTT CAGAGAGGGT GTGTGTGACA CTCTGCCATT TCCTTCTCAG TCTGACTGAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAAACTCAAG ACCACAGTCT GCTGCCTGCT CTAGCAGATT TCATTTTGTG ATAGCACGTC CAATAATGTT TGAGTCAGAG CTATGTCGTC ATCATAAAGT GTGTGTACTA TGTCTGTGTA  AACTGTGGCC CTAGGACCAA AGGACAGTAA TTATGCTGTG GTAGCTATTT TATACTGTAG TCAGTTTTTG ACAGGTAACT GAGCAGTCGA TCATTAGTGG TACATACAAA GGAGCTCACA  AACGTTTTCA TTGGAGCAAA GGCGAGCCCA TCTGTGCTCA AAATGTGGCC CTGTTTTTGT TTTGTTTTTT CTATACTCTG AACAAAATTC TTATTTCACC TGAATAAATT ATGTGTTTCA  CTTATATGGT GATGTTTTCA TGTTCATCAA CAAAACTGTC ACAATTTCTG AAAACCCTCG AATTTAAATA AATTGTAAAA TTAAGTAGGC ATTTGAATTT TCTCTGTATA CAATAATTTG  TAAAGATGAA TCAAACGCAA TTATTTATAT TTATACATAA GGATGAACAC ACAGATATAT ATTTGAAATA CTGGTATTCT CCTGTTTGGA TTGATTAGGA AGAAAAATTC TAATGAACAT  TTACAGGATT AGAATTAAAA AATATGTTGT ATTTCTTTGG TAGGGCTACC GCAGAAGTTT AATGTTGACT TAATCCATTC AAGACTTGCA TAAGAKAATT GTCTTGTTGG AACAATGCAG  GTTAAAATTT TACAGTAAAT TCAGAATTTT CACCTATTTT GCTCTAAGTT AAATTAGATT TTTTTTGTTT GAAATTAAAA TCTTTAACCC GTCACTCCCG AGTTCAGATA AAAAAATAAA  ATAAAAATAG TTATGACGGT AAATGTGAAT TTGTGACCAT TTTATCATAG TGTCTTTTCT CGTCTACGGC GGGAAAATTG CTAATTAAAG CTTATCGTTA GTTGACTGGA AGAGCTGCGG 
GCTTGGTTAC AAAATTTCGT CTTAGAGCGT ACTCAAAATT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTGCAGGCAACGCAAAGATTGGAAAACTGGCCCCAGACTTCTTGGCTAAAGCGGTGATGCCAGATGGACAGTTCCAGGACCTGAAGCTGTCAGATTATAGAGGTAAGATCTTTCCTT
CGCTGCAGGAAATGGTTTTTATTTTTTTAACAGACTCTTCCTATTGACATCTGAATTTATTCCCCCACTCCCTGCTTAGAGGTACAAAAATAATCTTGTCTTATTTCCTCTCTGCACAGG
AAAGTATGTCGTCTTCTTCTTTTATCCGCTGGACTTCACGTTCGTGTGTCCCACCGAGATCATCGCTTTTAGCGACGCTGCTGAGGAGTTTAGGAAGATTGGCTGCGAAGTCATCGCTGC
CTCTGTAGACTCTCACTTCTCCCATTTTGCATG
GTATTCAACAATCCTTTGTTTTTGCATTCTCGACGACTATGTATCGTGAGTGCTTAAAAATTTCCTGTTTTGTCGTTTTAAGGACAA
ACACACCACGTAAACAGGGCGGTCTGGGTGCCATGAAGATCCCACTTGTGTCTGACACGCGGCGCACCATCTCCACAGACTACGGTGTCCTGAAGGAGGATGAAGGCATCGCCTACAG
GT
GGGGCAGATGTTAGGTTTTGCCCTCTGGTCTATGCACCAATCTCAAAATGCTTTCCGATTACTAAAGGTCACAATTGACTTCCCAGCTTTCGCCTGCTTTACTTTTGGCTGATTTTTAAT
CGAACCAGTTTCATTGAACCTGATGTGGCATTTGTTGTAATTTGTTGTGAATTGATCCTAAAATCCACACGATTCATATACATTTCCTGTATTCTAGGGGTCTGTTCATCATTGATGACA
AGGGTATCCTGAGACAGATCACCATCAACGACCTCCCAGTTGGACGCTCCGTTGAGGAGACCTTGCGTTTGGTTCAAGCATTTCAGTTCACAGACAAACATGGAGAAG
GTTGGTGTGTTG
CTTCTGTTTTTGCCACTTTCTTTTGAAATTGTACACGCTTCCTTTCTGGAACCTCTTTTATCTTTAATCTATCTGCCTGGGCTCATTACTTGTTTATCTGTTCAGTCTGTCCAGCTGGCT
GGAAACCAGGAAGTGACACCATCAAGCCAGACGTGCAGAAAAGCAAAGATTTCTTCTCCAAGCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTGCAGGCAACGCAAAGATTGGAAAACTGGCCCCAGACTTCTTGGCTAAAGCGGTGATGCCAGATGGACAGTTCCAGGACCTGAAGCTGTCAGATTATAGAGGAAAGTATGTCGTCT
TCTTCTTTTATCCGCTGGACTTCACGTTCGTGTGTCCCACCGAGATCATCGCTTTTAGCGACGCTGCTGAGGAGTTTAGGAAGATTGGCTGCGAAGTCATCGCTGCCTCTGTAGACTCTC
ACTTCTCCCATTTTGCATG
GACAAACACACCACGTAAACAGGGCGGTCTGGGTGCCATGAAGATCCCACTTGTGTCTGACACGCGGCGCACCATCTCCACAGACTACGGTGTCCTGAAGG
AGGATGAAGGCATCGCCTACAG
GGGTCTGTTCATCATTGATGACAAGGGTATCCTGAGACAGATCACCATCAACGACCTCCCAGTTGGACGCTCCGTTGAGGAGACCTTGCGTTTGGTTC
AAGCATTTCAGTTCACAGACAAACATGGAGAAG
TCTGTCCAGCTGGCTGGAAACCAGGAAGTGACACCATCAAGCCAGACGTGCAGAAAAGCAAAGATTTCTTCTCCAAGCAGTAA

Retrieve as FASTA