1. Browse the Database
  2. View Redoxidase
Entry information : PretGPx01
Entry ID 13799
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-23 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-23 (Harold Duruflé)
Peroxidase information: PretGPx01
Name PretGPx01
Class Animal glutathione peroxidase    [Orthogroup: Gpx1004]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx01
start..stop		 S start..stop
DrGPx02 319 2.95e-113 1..188 1..189
CapGPx02 306 2.54e-108 1..189 1..189
BtGPx02 306 4.53e-108 1..189 1..189
CjaGPx02 305 7.1e-108 1..189 1..189
Gene structure Fichier Exons►


exon

Literature and cross-references PretGPx01
Cluster/Prediction ref. Genebank:   103458513
Protein sequence: PretGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   191
PWM (Da):   %s   21626.95  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFIAKTFYDLRATSLEGDSVDFNVFRGRVILIENVASLxGTTTRDFSELNQLQSKYPHRLVVLGFPCNQFGYQENCTNGEILHSLQHVRPGGGFKPNFTLFEKCDVNGANTHPVFAYLK
CKLPYPEDDPSSLVQDPRFLVWSPVSRADVSWNFEKFLIGPEGEPFKRYSRNFPTIDVEPDIQRLLRLTKT

Retrieve as FASTA  
Remarks
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST