Entry information : CsPrx56 (orange1.1g026183m)
Entry ID 1380
Creation 2007-02-14 (Christophe Dunand)
Last sequence changes 2012-01-04 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2016-09-07 (Qiang Li)
Peroxidase information: CsPrx56 (orange1.1g026183m)
Name (synonym) CsPrx56 (orange1.1g026183m)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue type Ovaries
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx56
start..stop
S start..stop
CclPrx16 707 0 1..350 1..350
CclPrx68 617 0 1..350 1..349
CclPrx05 615 0 1..350 1..350
CsPrx52 615 0 1..350 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 57455..57672 218 N° 2 58654..58845 192 N° 3 59697..59865 169 N° 4 60051..60523 473
join(57455..57672,58654..58845,59697..59865,60051..60523)


exon

Literature and cross-references CsPrx56 (orange1.1g026183m)
Literature Close,T.J., Roose,M.L., Federici,C.F., Fenton,R.D., Wanamaker,S., Kim,H.R., Kudrna,D., Wing,R. and Yu,Y. Development of EST Resources and New Genetic Markers for California Citrus - Ruby Orange Ovary at Anthesis.
DNA ref. Phytozome 12:   scaffold00043 (57455..60523)
EST ref. GenBank:   CF833267
Cluster/Prediction ref. UniGene:   Csi.2412
Protein sequence: CsPrx56 (orange1.1g026183m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (324)
PWM (Da):   %s   37834.18 (35236.8)  
PI (pH):   %s   8.58 (8.59) Peptide Signal:   %s   cut: 27 range:27-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATLRYLLAAALVVAIALEGSSPSQAQLSPxFYSSTCPNVTNIIRGVLQKAFLSDIRIGASLIRLHFHDCFVNGCDASVLLDNTTTIDSEKFAAPNNNSARGFEVIDQMKAAVEKACPRVVSCADILTIAAEQSVALSGGPSWTNLLGRRDSRTANRTLANQNLPSPFDTLDRLKASFRNVGLNDNFDLVALSGAHTFGRAQCRFFSVRLFNFNNTGNPDPTLDATFLQQLRQLCPQGGNGSVLTNLDVTTPNVFDNKYFSNLRNRKGLLQSDQELFSTPGADTIDIVNVFRKNQAAFFKSFVTSMIRMGNLKPLTGNEGEIRLNCRRVNGNSNIVTRSSSSEGDTISSF

Retrieve as FASTA  
Remarks complete sequence from genomic and 2 ESTs. Incorrect prediction from Phytozome (exon 1 and part of exon 2 are missing: "n" in the eintron 1 and frame shift in the PS).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACTCTGCGTTATCTTCTTGCAGCTGCTCTTGTAGTTGCTATTGCTCTTGAGGGATCATCACCATCTCAAGCTCAACTGTCTCCCTTNTTTTATTCTTCCACATGCCCTAATGTA
ACCAACATAATTCGAGGGGTGCTTCAGAAAGCTTTCTTGTCCGATATTCGTATCGGTGCCAGCCTTATCAGGCTTCATTTCCATGACTGTTTTGTTAA
TGTATCAATCTCTAATCTTTGT
TTTTTCTTCTATTTACTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTCTTTAGTGGGCTTTAAA
CAAAAATATAGTTTTACTTAAAACCTAAAGAACAGTTTGAATATGTCATTTTTAAAAATCCAAAACCCTTTTTATATATCTTTTTTTTAATTGCTTTTACTTGTATGCTGCTTGTGCATC
CTTGTTCTGCCCGCATATTCATAAATTTAAAGAGACTTTTTCCCCCTAAAAGATCTGATTTTTTCAATTCATAGGACGATTTTTTCCTTTCTAATTTCGATGCACCGAAGGCCGTGTAAT
TTTTCAAAAAGACACTTATATATGTGATTTTCATACATTAGAAATTAAAATCAAATAAAGACTTAGCCTAAATCAAGGATTAAAATCCTCTAGTGATCTATTTCTTGTTGAGTGCTTTTG
ATGATGCCTTGAGTCTATTATTAATATAGTTTAAAATTTAACTACTCCAACTGAAAAGCTTAAGTCGGGAGTAAATCCTAGTCTTGAAAACATATTTGACGATAAGACAATTACAATAAG
AAGAGTTTGCGTTACTTTTTATTTATTTGTCATGAGATAAGAAGGAATCCATCAACTTATTAAATTAACGATACAACGACACTTAACATGACAAATTATTAATTAACAATATCATTTCAG
GGCTGTGATGCATCAGTTTTGTTGGACAACACTACAACCATAGACAGTGAGAAATTTGCTGCGCCAAATAATAATTCGGCGAGGGGTTTTGAAGTTATTGATCAGATGAAAGCTGCCGTT
GAAAAGGCCTGTCCAAGGGTTGTTTCCTGTGCTGATATTCTCACTATTGCAGCTGAACAATCTGTTGCTTT
GGTACGAATTTTTATTAACAACTCCACTTCTTTAATAATAAAATAATTN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCGTCGTGAAATGATAATTTTACCTTTATGATATTAAAAAAATTCTAAAAAAAATATTTTTTAACAAATTAA
AAAAATAAGTGATACGTGGATAATTACTCAAAAAATAATTCTCACGGAAAAATGGAAAAATTTTGAATCCACGTTTTTATTCTTGCATTGTTGCATGTGCATTTCAACGAGAAAACTACA
AAAGTCTAAGATGTCATTGTCCTACCACGTGGTAATTGATTTAAAAGTTGTGATGGGATTCGTCATGGAACCGATCACTTTTAAGATCCCATCGTTTTCAACTATGACGTTGGATTTCAT
TACACGACAAAGCTTGATCCAAAATTTTATGGCGACGTGATAAGACTACCACATTATTAGCCAAATGATCCGACCCAAACACACACAAATTGAAAGCCCGAAAGATTAATTGTCTATTTC
TGATTTTGATAAAATTTGCTTATTATACATCTCTTAAGTTTATTGCTGATCGTGAGTAATGAACTGAATGGTTTTGGTTACAGTCAGGGGGTCCTTCGTGGACAAATCTATTGGGAAGAA
GAGACAGCAGAACAGCAAACAGAACTCTTGCAAATCAGAATCTTCCATCACCGTTTGATACTCTTGACAGGCTCAAAGCTAGTTTTAGAAATGTCGGCCTCAACGATAATTTTGATCTTG
TTGCACTCTCC
GGTAATTATTTTGCTTCTCGCCCTTTAATTTTAAGTAAAGTTATGAGAGTAAATTTTTAGAGGTCCAGGATTCCACGTGGAGCGGTCATCTAAATAAAGGTAGTCATGC
TACAGCAAATTATGTTATTATCACTAAGCGAATTATAATATTATTCCTTGTATGAATAGAGCATGTATAATTTTCAGGAGCTCACACATTTGGAAGGGCTCAGTGCCGATTTTTCAGCGT
AAGATTATTCAATTTCAACAACACTGGCAATCCAGACCCAACCCTAGACGCAACCTTCTTACAACAACTGAGGCAACTATGCCCACAAGGTGGAAACGGCAGCGTTCTAACAAATTTAGA
CGTCACAACACCTAATGTTTTCGACAACAAATACTTCTCCAATCTCAGAAACCGCAAAGGCCTTCTGCAGAGTGATCAAGAGCTGTTTTCGACTCCCGGTGCCGATACCATTGACATTGT
CAATGTCTTTCGCAAGAACCAGGCTGCTTTCTTTAAAAGCTTTGTGACTTCAATGATAAGAATGGGGAATTTGAAGCCACTGACGGGAAATGAAGGGGAGATTAGATTGAACTGCAGGAG
GGTCAATGGAAACAGCAATATCGTAACAAGATCATCATCGTCAGAGGGTGATACGATCAGCTCTTTCTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACTCTGCGTTATCTTCTTGCAGCTGCTCTTGTAGTTGCTATTGCTCTTGAGGGATCATCACCATCTCAAGCTCAACTGTCTCCCTTNTTTTATTCTTCCACATGCCCTAATGTA
ACCAACATAATTCGAGGGGTGCTTCAGAAAGCTTTCTTGTCCGATATTCGTATCGGTGCCAGCCTTATCAGGCTTCATTTCCATGACTGTTTTGTTAA
GGGCTGTGATGCATCAGTTTTG
TTGGACAACACTACAACCATAGACAGTGAGAAATTTGCTGCGCCAAATAATAATTCGGCGAGGGGTTTTGAAGTTATTGATCAGATGAAAGCTGCCGTTGAAAAGGCCTGTCCAAGGGTT
GTTTCCTGTGCTGATATTCTCACTATTGCAGCTGAACAATCTGTTGCTTT
GTCAGGGGGTCCTTCGTGGACAAATCTATTGGGAAGAAGAGACAGCAGAACAGCAAACAGAACTCTTGCA
AATCAGAATCTTCCATCACCGTTTGATACTCTTGACAGGCTCAAAGCTAGTTTTAGAAATGTCGGCCTCAACGATAATTTTGATCTTGTTGCACTCTCC
GGAGCTCACACATTTGGAAGG
GCTCAGTGCCGATTTTTCAGCGTAAGATTATTCAATTTCAACAACACTGGCAATCCAGACCCAACCCTAGACGCAACCTTCTTACAACAACTGAGGCAACTATGCCCACAAGGTGGAAAC
GGCAGCGTTCTAACAAATTTAGACGTCACAACACCTAATGTTTTCGACAACAAATACTTCTCCAATCTCAGAAACCGCAAAGGCCTTCTGCAGAGTGATCAAGAGCTGTTTTCGACTCCC
GGTGCCGATACCATTGACATTGTCAATGTCTTTCGCAAGAACCAGGCTGCTTTCTTTAAAAGCTTTGTGACTTCAATGATAAGAATGGGGAATTTGAAGCCACTGACGGGAAATGAAGGG
GAGATTAGATTGAACTGCAGGAGGGTCAATGGAAACAGCAATATCGTAACAAGATCATCATCGTCAGAGGGTGATACGATCAGCTCTTTCTA

Retrieve as FASTA