1. Browse the Database
  2. View Redoxidase
Entry information : PretGPx08
Entry ID 13806
Creation 2016-06-23 (Harold Duruflé)
Last sequence changes 2016-06-23 (Harold Duruflé)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2016-06-27 (Harold Duruflé)
Peroxidase information: PretGPx08
Name PretGPx08
Class Animal glutathione peroxidase     [Orthogroup: Gpx1005]*
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretGPx08
start..stop		 S start..stop
DrGPx07 253 9.42e-88 5..148 43..186
BtGPx07 223 7.23e-76 5..148 43..186
OarGPx07 222 9.51e-76 5..148 43..186
XlGPx07 222 1.08e-75 5..148 41..184
Gene structure Fichier Exons►


exon

Literature and cross-references PretGPx08
Cluster/Prediction ref. Genebank:   103463138
Protein sequence: PretGPx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   148 (304)
PWM (Da):   %s   16689.6 (33205.6)  
PI (pH):   %s   8.22 (8.01) Peptide Signal:   %s   cut: 26 range:26-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVILRTQVSLVVNVASECGFTDQHYRDLQQLQRDFGPFHFNVLAF
PCNQFGQQEPGSDKEIDSFVRTVYGVSFPLFSKIAVVGTGANNVYKHLAEVSGKEPDWNFWKFLIDVDGRAVDAWGPKVPVTQIRPKIADMVRQIILKKKEEL

Retrieve as FASTA  
Remarks
Promoter►
Send to BLAST
Send to cis Analysis
Terminator +►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST