Entry information : PretPOX04
Entry ID 13814
Creation 2016-06-27 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2016-06-27 (Harold Duruflé)
Peroxidase information: PretPOX04
Name PretPOX04
Class Non mammalian vertebrate peroxidase     [Orthogroup: POX001]*
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretPOX04
start..stop
S start..stop
PretPOX02 357 1e-122 281..503 1..226
SiniPOX 266 5e-81 287..461 583..759
SiniPOX 213 2e-61 11..156 9..154
SiniPOX 151 2e-39 190..279 21..110
TrubPOX01 247 7e-74 287..447 582..740
TrubPOX01 214 2e-61 1..156 1..154
TrubPOX01 159 4e-42 168..279 1..110
DrPOX01 208 1e-59 287..470 583..756
DrPOX01 181 1e-49 2..153 3..153
DrPOX01 129 6e-32 190..279 23..112
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..64 64 N° 2 146..233 88 N° 3 348..523 176 N° 4 624..756 133
N° 5 10031..10068 38 N° 6 10264..10329 66 N° 7 10413..10500 88 N° 8 10598..10773 176
N° 9 13974..14241 268 N° 10 14337..14548 212 N° 11 14655..14692 38 N° 12 14802..14960 159
N° 13 15121..15129 9  
join(1..64,146..233,348..523,624..756,10031..10068,10264..10329,10413..10500,105 98..10773,13974..14241,14337..14548,14655..14692,14802..14960,15121..15129)


exon

Literature and cross-references PretPOX04
Cluster/Prediction ref. Genebank:   103473904
Protein sequence: PretPOX04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   504 (486)
PWM (Da):   %s   56941.47 (55089.4)  
PI (pH):   %s   8.25 (8.16) Peptide Signal:   %s   cut: 19 range:19-504
Sequence 545
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLSVLLVLGVCLVPSKSKPMEERLGSPFLHKCFEEAKKIVDDAYKYSREESLRRVRKDEVQPRDALHLLKQPRGDTRSAVRSADYMAQTLRLVQEKVHRVHKRSLNATDLLTEQDLRELARITGCEARIRNPPCHNTPNINKYRTITSVCNNFRTCSSRKGGEALEMLLSVLLILGLILVPSQSKPTGERLGSPFLQKCFEEAKKIVDDAYMYSREESLRRVRRDVVKPHDALRLLKQPRGDTRSAVRSADYMAQTLRLVQEKVHHVHKRSLNATGLILMISITSGYNAWRRFCGLSQPRNQAELAQVMRNPTLAQKLLELYGTPDNIDVWLGGVAEPFVPGGRVGPLFACLIATQFQKIREGDRLWFQNPGVFTPQQRQALFAVTLSRVICDNTGITSVPSDAFSVVSNRNRLVRCSALRRLDLFPWRERPCGFGSPEDCLRSSDGENPTQTDELNTLDPQDPLDLQDPLDPVDPFDLQDPLDPQDPVDPQDPLELETNEIQ

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTGGTATT CTGGACTTAT TTGCCTCTTG GACAAAAAAA TATATATAAT TGGCTTTTGT TCTACATATT AATTAGACAC AAATTGACAT TGGAGACTAT CTGGATAAAA TTCAGATTTG  TCTTTTTAGG CTTTTAGAAT CCAAAAACTC TTTAGGAATC AAATATCTTA CAATCCCATC AAAACCTAGA TCAGCAACAC ACCTATCACA ATTTTTTTAA AATCAGATTT TCATGTCAAA  ATCAGATTAA CTTCTTGTTC AATAATACCC TTTACTCCCA GTAAGAAAGA CTTTGCCTTC ACCTCTCTCT TGTGCAACAT TTGCATGTTT AAGCCCATGT CCACCTCTGT TTATACTGAA  CAGTCCAGGC AGTCTGGAAA ATTAAGATTC ACCCAGCTGC CAAATCTGGA TTCTAAAGAA ATTAGTCAGC TGAAGACAAA AGAAAGCACC ACATTAGTTT TGTTTTTCAG TTATAAACAA  AAGTGAGCAT TTTCAAGCAA TGCAAGGCTA TTTTTTCATT TATTAATATT TTCTTTTCTA TCATATAATG TAGGTTGAAG GATTCATTGT GTAACTGAAG ATTTTGAATA TAAGTGAGGA  GTTTAGTGAT ATTTTAAAAT GTGGCAGAGG AACATTGGCT CCCTCTGTTG GTCACACTCT GATAACTTGA CTCTCTTTTG AAAATAATTT CTTGCTGCAA ATTAAAGCAC CGGACCAATC  AGAACGACTG AAAAAAAGAG AAGATTATCC TATAAATTAT ATATAAAAAA ACATATAAAT AAAAAGAGTA CTTCTGCTGA AGCATAAAGT AATCACATTC TTTCTTATTT ATTTATTTTT  TTTTATTTTG GTTCAAATAG TCTCAATTTT AATTTTTATA CTTTACCTTG TATTGGTACA AACATATATT TTTTATTTTT CACTTTAACA TTTTTTAATA AAATAATTTC ACATTGACAG  AAGAGCTGTA TTTCTGAGGG AGAATGCAAT TCAATTTAAG ACTACAGAAT TGCAGTAAAA CAAAAATATT GGCAGACAGA GCATAAAATA TAACATTTTC ATTTTTAAGC TACCATGATT  TGTATAGCAT AGCATTAATG TTAGTTAATC CAGTCAAAAC TGACTGAGTG CTGATTTTTG TTTTAATGGA CTATAAGCTG TAATAGAGTT AAACAGATTA ATTCAATAAA AACCCATGTT  TATTTAGCTA AAACCATCAA AAGTGTCTTA TTATTATAGT AAATGAGGAT ACAGTTGTAT GGTGTGTCTT TAAAAATAAA TCATCATTAA AAAACTCATA CAAAACAGTG ATCGCTCAAT  TGCTTTATTG AATACAACAT TCAACATTCA ATGCAAAACA ACAAAGTTGC AGTAAAACAA AAATATGATC AGATAAATCA TAACACAATA TTTGAAGGTA AAGGATTTAA TGTAAAACAT  GTTCATAAAT TAATACTGGT TGATCCCATC AAAATTATCC TAATGATTTT GTTTTTTGTA AAATAGACTA AGTTGTAACA GAGTCAAACA CATTTGTTCA ATTAAAACCC ATTGGTATGA  AGCTAAAACT AACAAAAATG CCTTATTATT ACAGTGGAGA GTAAAATGAG GATGCAGTGG TATGGTGTGT CTTTATCTAG TCATCTGCTG CTGTGAATGA CTGACGTAAA CAAATTTAAA  AGCCCACGAG TCACTGGTGT TTTCTAACGG GAAGTTCATC CAGGAAAGAG AGTGTTTCTG TCCCATAGAG AAGAAAATGT CCTGAGAAGA AGACGTTGAC GGCCAGCTTG ATAAATTTCA  TCGTAATCCC AGCTTTCTGC TTCGATGGAA GAAGTGCAGA GTCAATGACT GAGGAATATA AACAGGTGTG TCCTAGTTCT GTGTTGGCTT GTTTTGTTTC TTTATGACGG AAACAAATGA 
GTCTCTCTGG GTAAAGGCCG TCATCCCAAA ACTGATGTTT GAATATCGGT GATCCTAGAG GGCATATGGG GCTGAATGGC C 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTCTGAAGCA AAGCATCAAA CAAACATCAA CTGGTTAAAA AATACAATGA ATCGAAAACA TTTTCCTCTA TGGATTAAAA GAACATTTTT ACCTCTGTCT GTGAAGGTTT CTGTGGCGTT  CTAAGATGTT ATTTGATGTC TGGAGGTAGT GATGCCGTGT TCTTTCCCTT CTTATACTCG GTGAATTGGC CCAACGCCTC GCCTCCTTTA GAGGATCAGC AGGTGTGGCT ACGGTCACTT  TCTTGTTCTT TGTCAAAGTA CTGTAGGAAA CACTGCTTTT ACCTAATCAA CTACAGCTTC TGGTTAACTT ATAAGACTTA TTTAGGACCT ATTAATGCAC CGATTGCAGT TTTCTGGTAG  ATTGCGACTA CCAATATTTA AAAAGCCTGA CCGGCCGATT CCGATTTTGG CCGATACCAA TGCTTCTTGT CTGAAATGTT GTTGAGTTGG CAATAGTGGG GTGACTATTG TTAACTGGAA  ATGTGCAGAC ACGATCTGGT CAGTGGGTCT GTCAGTCATA TCTCTCTCAC AGCAGAGTAT TAGGGGACAG TAGTTGATTT TTAGACCTTT GTTGAGGTAG ATAAGATCGT CCGATCTAAA  AAATTTGGTT GGTTGCACCC CTATTAGAAA CCTACAGTGG TGGGAAGTAA TGTACTTAAG TACAGTTTTC GTGTATCTGT ACTTTACTTA AGTAGATTTA ATAATGGGGA CTTTCTACTT  TTACTTCACT ACATTTTACA GTAAGTATCT GTACTTTCTA CTTCACTACA TTTCTACAAA ASTGTCGCGT TACTCGTTAC ATCCAAGTCG CGTTGCTCTT TTCTTCCGTT AAAATGTGAA  GTTCAGGGAT TTAAGGTGGC GCCGTAAAAT CCGAGCAATA ACGTGACTTA GTGTCTGTTG TCACCCATCG GCTCCACCTT TACTCGCACT CGGAGCTCCA GACATGCGCA GTGGTTTCCT 
CTGAGCGGGA GGAGATGTTT GTCTATAATA TAATAGCTGC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACTGGATCTGAGGAGAAATAAATATTTTGTCAAAATGCTGAGAAGATGAAATGAGTAGAGTATTGTTTGCACATAATAATCAAAATTCATAAAACAACCAAATCTGAGTTATGATAAAA
AAAATTATACAAATGATCTTTATGAATTTACTACTCAGAATCAACTACCTCATTGGTCTCAAGTTCCAGTGGGTCTTGTGGATCCACAGGGTCCTGGGGGTCCAGAGGATCCTGAAGGTC
GAAAGGGTCCACGGGATCTAAGGGATCCTGGAGATCCAGTGGGTCCTGCGGGTCCAGAGTGTTCAGTTCATCTGTCTGGGTTGGGTTCTGTTTATCAACAAGAAATAAACATCACACTAA
GTGTTTGGATTTCAAAAGATCACATTATTCCTTTGACAATGTGCGACATTATTTCAGTAATAAAGGTGAGACTGACCTCTCCGTCACTGGACCTCAAACAATCCTCAGGAGATCCTGAAT
CATCAAACATAATAAGTTTTTATACACATAATTTCCAAAAAG
CACATTACATTGTCTAAAACTGTGCTTTGATTGGTCCCTTGTATGAAAAAGTTCTCACCGAAGCCACAGGGTCTTTCC
CTCCATGGGAACAGATCCAGACGACGCAGAGCGGAGCACCTCACCAGACGGTTCCTATTTGAGACGACGCTGAAAGCGTCACTGGGCACAGACGTGATGCCGGTGTTGTCACAGATGACT
CTGGAGAGTGTAACAGCGAACAGAGCCTGCCTCTG
CTGTGGCGTGAAAACACCGGGGTTCTGGAACCACAGCCTGAAAAATTACAGAACTTTGGTAAATTATTCTATTCAAATCTACGAT
TTGCTTTTGAGAAAAGAAATCAAACAGTCCTACTCTGCTTTACTGACCTGTCACCCTCACGGATTTTCTGGAACTGAGTTGCAATGAGGCAGGCGAACAGAGGACCCACGCGGCCGCCAG
GCACAAATGGCTCTGCGACTCCTCCAAGCCACACATCAATGTTGTCGGGGGTCCCGTAGAGCTCCAGCAGCTTCTGAGCCAGCGTGGGATTCCTCATAACTTGAGCCAGCTCTGCCTGGT
TACGAGGCTGGGACAGACCACAGAACCTGCGCCAGGCATTGTAGCCTGAAGTGATAGAAATCATGAGGATGAGACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNAAAACTTACAAGTTGTTGCAGACGCTGGTGATTGTGCGATACTTGTTGATATTTGGTGTGTTGTGACATGGTGGATTCCTGATTCGAGCCTCACATCCAGTAATCCGGG
CAAGTTCTATAATGTCTTGGTCCGTGAGAAAATCTGAAATGTATAGTTCAGCGATCCATGAGTCCTTTTTGACTTTTAAGTATAATTAGATTGTTATTTAGAAGCACAAGACTTTTAACC
AGAAAAGGAAAAAATCAGCTTTGACTGAGCCTTACCTGTTGCATTGAGGGAGCGCTTGTGCACATGATGTACTTTCTCTTGGACCAAACGGAGAGTCTGTGCCATGTAGTCAGCAGAGCG
CACAGCTGAACGAGTGTCACCGCGAGGCTGCTTCAGGAGGCGAAGAGCATCATGCGGCTTCACCACATCCCTGCGGACCCGTCTGAGGCTCCTGCAGGAGAGAGAATGGAAATGTCTCTC
AGTTTTAACAAGAAATCCAGAGCTCTGCAGTTCAGAAAACTGCTCATCACTCAAGATGATGAACTCACTCTTCTCTGGAGTACATGTATGCGTCGTCTACTATTTTCTTTGCTTCTTCAA
AGCATTTCTGAAGAAAAGGACTGCCCAGTCTTTCACCTGAAGAATAAGAACAGCTTAAACATCATGCATTTACAAAGCAAATATGTAAAAAAAAAAAAATTATGTCAGGAGAAATTTACC
TGTAGGTTTGGATTGACTGGGCACCAGGATGAGGCCCAGGATAAGAAGTACAGAGAGAAGCATCTCTAAAACAAAACATCAAACAAACGTCAACTGGTTAAAAATACAATAAATTGAAAA
CCTTTTCCTCTGTGGATTAAAATAAATCTTTCTACCTTTGTCTGTGAAGGCTTCTGTGGCTTTCTAAGATGCTCTTTGAGATCTGGAGGTAGTGATGCTGTGTTTAACTCTCTGGCTCTC
CTTATATTCAGTCGACTGACCCAACGCCTCGCCTCCTTTACGGGATGAGCAGGTGCGGCTATACCGTCAGGAAATGCAGTTCCTTCTTCCTTATCAAAGTCCTGCAGGAAGCACTGCTTT
CAGCTAATCATTCACAGCTTCTGGTCAACCGATATGACTAATGGTCTACTTTAGAAACCTAAAAACAACAATACAATAAGTTCTGCTGGATGGGTTGGCCAGAAAGCAGCATAAACATAG
TAACACTGACATATGGGGATAAAACGTTTAAATAACTTTAATCAAAACTCATTTTTCAATGTCCTTTTTCAAAGATAATTTGATGAAGGTAAAGGAGTAACAAAAAAAATCCAGCCAAAC
ACTGAAATGAAATGATATAGATTTGTTTGGTTTCAAATAATTTTTCTGTGTTGAGTTATACTTTGGTAAACTAAATAACAACAAGCAAGTTTAACTTTAGCATTTAACATTATAGTGTTT
TCTGCTTGAACCACAAATGAGAATTAAAGTGGAATAAACCAACATATTGCGTTAGATTCATATCAAAAGGTTTAATCTAGCTTCATGAAATTTTATTATGATATGAAATAAATGACAAAG
GAAAAGAAGGACACTTGCTTTTGGAAAAAGCTTTTCTTCGGAATACTTTACTGATAGTAGAACAACACAGAAACTACAGATAAGAAAAATAAAATAAAAAGCAGAAACAGTTTAGTCTTT
ACCAAATGAAGACAAAAAAATCTAAATAATATGGAAATTCGAAGAATCAATTTTGTTTACATAGCATTTAATGGAAGAAAAAAAAATCCAAAATATTTTCATTTGAAAACAATGCTGTAA
TGACTGAAAATGTGAATCACAGAGGTAAGGAAATAAGAAAGCAATCCTGCATTTGTGCAAGACAAGGAAGTGAAACAATAAATGTAAAGTTAATCATTATGTTTCTTTGAAAAGCACAGT
GTGTGTATTTTATGCTAGTGTGATGGACCGAGTTAAAACAGGAGGAGTCACAGGATATTAATTAGAAAAATAGGGTTTTTTATTTTAACCCAAAGATTACAAAAGGACAAAAAGATGAAC
TGAGCTCACAAAAGAGGCCAAAGAAACAAAACTGAACTCAGGCAAAAAAGTAAACAAACTGGCTGCACAAACAAACATAACTGACCTAACAAAGAGATGACACACAGGGGTTTATATACT
GGCTGATCAGACCAATTAAGACACAATAGGGGTAACTAAACAGAATACAATTACAAACACAAAAACAAATAACAGTACAGCTAAGTTTGGCTAAACTAAAGATTCTCAAAATGAAAATCA
AAAATATTAAAGTTTAAATACTAATATTTACTTAAATACAAAACTTATCTAAACAAAGAAACTACAAATTTCCCCTGCCAGCAGGAACTAGTGNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAACTTACAAGTTGTTGCAGACGCTGGTGATTGTGC
GATACTTGTTGATATTTGGTGTGTTGTGACATGGTGGATTCCTGATTCGAGCCTCACATCCAGTAATTCGGGCAAGTTCTCTCAAATCCTGCTCCGTGAGTAAATCTGAAAGGTGTAGTC
CAAATATCTGTGTGTCCTTATAGGTTT
TTAGATGTAATCAGATTGTTAAAAGTACCAGATATGGAAAGATATGACTGAGCCTTACCTGTTGCATTGAGGGAGCGCTTGTGCACACGATGT
ACTTTCTCTTGGACCAAACGGAGAGTCTGTGCCATGTAGTCAGCAGAGCGCACAGCTGAACGAGTGTCACCGCGAGGCTGCTTCAGGAGGTGAAGAGCATCACGAGGCTGCACCTCATCC
TTGCGGACCCGTCTGAGGCTCCTGCAGGAGAGAGAATGGAAATGTCTCTCAGTTTTAACAAGAAATCCAGACCTCTGCAGTTCAGACATTCAGAAACCACCCTTCACTCAAGATATGAAA
GCATTCTGAACTCACTCTTCTCTTGAGTATTTGTATGCATCGTCTACTATTTTCTTTGCTTCTTCGAAGCATTTATGAA
GAAAAGGACTGCCGAGTCTTTCCTCTGGAAAGCAGGAAGAA
CAATTTAAATATAATACCTTTAAAAAGCAAACATGTAAAAGAATATATCTCAGGAGAAATTTACCCATAGGTTTGGATTTACTGGGCACCAGGCAGACGCCCAGCACAAGGAGGACAGAG
AGAAGCAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACTGGATCTGAGGAGAAATAAATATTTTGTCAAAATGCTGAGAAGATGAAATGAGTAGAGTAAATTTACTACTCAGAATCAACTACCTCATTGGTCTCAAGTTCCAGTGGGTCTTGTGG
ATCCACAGGGTCCTGGGGGTCCAGAGGATCC
AAACATCACACTAAGTGTTTGGATTTCAAAAGATCACATTATTCCTTTGACAATGTGCGACATTATTTCAGTAATAAAGGTGAGACTGA
CCTCTCCGTCACTGGACCTCAAACAATCCTCAGGAGATCCTGAATCATCAAACATAATAAGTTTTTATACACATAATTTCCAAAAAG
GACGCAGAGCGGAGCACCTCACCAGACGGTTCC
TATTTGAGACGACGCTGAAAGCGTCACTGGGCACAGACGTGATGCCGGTGTTGTCACAGATGACTCTGGAGAGTGTAACAGCGAACAGAGCCTGCCTCTG
NNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAACTTACAAGTTGTTGCAGACGCTGGTGATTGTGCGATACTTGTTGATATTTGGTGTGTTGTGACATGGTGGAT
TCCTGATTCGAGCCTCACATCCAGTAATTCGGGCAAGTTCTCTCAAATCCTGCTCCGTGAGTAAATCTGAAAGGTGTAGTCCAAATATCTGTGTGTCCTTATAGGTTT
CCAAACGGAGAG
TCTGTGCCATGTAGTCAGCAGAGCGC
AATGTCTCTCAGTTTTAACAAGAAATCCAGACCTCTGCAGTTCAGACATTCAGAAACCACCCTTCACTCAAGATATGAAAGCATTCTGAACTCA
CTCTTCTCTTGAGTATTTGTATGCATCGTCTACTATTTTCTTTGCTTCTTCGAAGCATTTATGAA
GAGAAGCAT

Retrieve as FASTA