Entry information : PretPOX05
Entry ID 13816
Creation 2016-06-27 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2016-06-27 (Harold Duruflé)
Peroxidase information: PretPOX05
Name PretPOX05
Class Non mammalian vertebrate peroxidase     [Orthogroup: POX001]*
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretPOX05
start..stop
S start..stop
SiniPOX 235 8.18e-75 1..128 126..253
TrubPOX01 214 5.4e-67 1..128 126..252
DrPOX01 178 9.65e-54 1..128 128..255
TrubPOX02 170 9.02e-51 4..128 79..203
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13816' 'join(1..80,349..478,1020..1193)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..80 78 N° 2 349..478 128 N° 3 1020..1193 172  
join(1..80,349..478,1020..1193)


exon

Literature and cross-references PretPOX05
Cluster/Prediction ref. Genebank:   103461605"
Protein sequence: PretPOX05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   128
PWM (Da):   %s   14584.11  
PI (pH):   %s   8.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ARIRNPPCHNTPNINKYRTITSVCNNLKNPRLGASNTPFTRWLPSEYDDEISQPKGWNRNRRFNNFLLPVRQVSNSILSTTDAGVVNDTEYSHMVTFFGQWNDHDLSFTPFSPSIRSFSN
GLNCDES

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTCGAATCAGGAATCCACCATGTCACAACACACCAAATATCAACAAGTATCGCACAATCACCAGCGTCTGCAACAACTTTTGTAAGTTTTAGATCACAATTAAGATTTTATTAAATTTA
AAACAGTTTTGTAGGACCGATTGATCATCTATTTTAAGAACTTGCTCTTAGAAACAAATGTAGGGTTTATTGGTGCACACCATAATTTTTAGAAGTTCCTTTTTATATCAAAAAGTTGAA
ACTTACCTCTAGAGAAGTACTTGTGAAATCCACTCTAACATCTTAGGCCACAAAAGATGTGTTCACTTCTGTGGGATTTCAAAAGTTTGATTTCTACATTTCTTTTACAGAAAAAACCCT
CGCCTCGGTGCCTCCAACACCCCATTCACCCGCTGGTTGCCCTCTGAGTACGATGATGAGATCTCCCAACCAAAAGGATGGAACAGAAACCGCAGATTCAACAACTTCTTGCTCCCATTG
TGGTACCAACTTAGTTTCCAAAATCCAGACTTATTTAACCAAATATTTGTCTCAAGTTTAAAATTACAGTATTTTCCAGACTATAAGCCACACCTACAAAAAAAAAAAAAACTGGAAACG
TACATATTTAAGCTGATGGTATCTTCATCGCTGCGTCCCCATGAATTTGTTCACGCTGAGTTTACGTGCAGAGGCTCTAGTTCTCTCCTGTACTGCCAGATAAATAGCCTTCAACTTCAA
AGCTGCATCATATGAACTTCTTCGTTTTGTTTCCATGATGAAAGGCTATGAGTTTGAAAACATTTCTCCAACGTGCCTGCTGCTAGCATGTCCTTGTTCCAAATGAAAATCAGCACATTC
TTCTTTGATTTCCAATTTTGACTTCCATTGATTCACCTCTTGCTAAAGCGCCCCTTGGTAGTTGAACAAAAATACACAGAAAAGCCGCACCGGGCTATAAGCTGCGTGGTTCAAAGCGTG
GGGGGGGGAAATGGCGGCTTATAGTCCGAAAAATACAGTATATAATTTTCTCTCCACTTTTAGGTGCGGCAGGTGTCCAATAGCATCTTGAGCACAACAGATGCAGGCGTTGTCAATGAC
ACAGAGTACTCTCACATGGTGACCTTTTTTGGCCAGTGGAATGACCATGACCTCTCCTTCACACCATTTTCACCAAGTATCCGCTCCTTTAGCAATGGGCTGAACTGCGACGAAAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTCGAATCAGGAATCCACCATGTCACAACACACCAAATATCAACAAGTATCGCACAATCACCAGCGTCTGCAACAACTTAAAAAACCCTCGCCTCGGTGCCTCCAACACCCCATTCACC
CGCTGGTTGCCCTCTGAGTACGATGATGAGATCTCCCAACCAAAAGGATGGAACAGAAACCGCAGATTCAACAACTTCTTGCTCCCATTG
GTGCGGCAGGTGTCCAATAGCATCTTGAGC
ACAACAGATGCAGGCGTTGTCAATGACACAGAGTACTCTCACATGGTGACCTTTTTTGGCCAGTGGAATGACCATGACCTCTCCTTCACACCATTTTCACCAAGTATCCGCTCCTTTAGC
AATGGGCTGAACTGCGACGAAAGT

Retrieve as FASTA