Entry information : CsPrx37 (orange1.1g021171m/Cs6g09680)
Entry ID 1382
Creation 2007-09-10 (Christophe Dunand)
Last sequence changes 2016-01-18 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2017-12-14 (Qiang Li)
Peroxidase information: CsPrx37 (orange1.1g021171m/Cs6g09680)
Name (synonym) CsPrx37 (orange1.1g021171m/Cs6g09680)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation N/D
Tissue types Fruits
Ovaries
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsPrx37
start..stop
S start..stop
CclPrx52 644 0 1..316 1..316
PtPrx74 476 5e-171 7..315 12..320
StPrx34 469 2e-168 6..315 9..319
LePrx22 467 1e-167 6..315 8..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 82307..82510 204 N° 2 82622..82816 195 N° 3 83961..84512 552  
join(82307..82510,82622..82816,83961..84512)


exon

Literature and cross-references CsPrx37 (orange1.1g021171m/Cs6g09680)
Literature Chaparro,J.X., Bausher,M.G., Dang,P., Hunter,W.B., McKenzie,C.L., Niedz,R.P. and Shatters,R.G. Jr. Expressed Sequence Tags from Immature Ovaries of Valencia Sweet Orange (Citrus sinensis (L.) Osbeck).
DNA ref. Citrus sinensis Annotation Project:   chr6 (11455201..11457667) Phytozome 12:   scaffold00233 (82307..84512)
EST ref. GenBank:   CK936198.1 [5' end]   CF504009 [3' end]
Cluster/Prediction ref. UniGene:   Csi.8134
Protein sequence: CsPrx37 (orange1.1g021171m/Cs6g09680)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (295)
PWM (Da):   %s   34303.58 (32024.4) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.79 (8.64) Peptide Signal:   %s   cut: 22 range:22-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYRGIFHVVLILAFAATAFSTLSPCYYDKVCPEALPTIKRIVEAAVEKEGRMGASLLRLHFHDCFVQGCDASILLDDTSTIDSEKNAIPNNNSVRGFEVIDLIKKELDKVCKRPVVSCADILAVAARDSVVALGGPTWKVPLGRRDSTTANRTLANNDIPSPFLNLTGLISSFRRQGLNETDLVALSGGHTIGFARCSAFRNRIYNATNIDPDFAKERQRTCPSTGGDSNLAPFDPTPLTFDGKYFSSLLQKRGLLISDQALFNGGSTDGLVKTYSLNFKAFSADFANSMIKMGNINVLTGNKGQIRSNCRRLNN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 5 ESTs. Cultivar="Valencia".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTATAGAGGCATATTTCATGTCGTTCTCATTTTGGCTTTTGCAGCTACAGCTTTCTCAACCCTTTCTCCTTGCTACTATGATAAAGTTTGTCCCGAAGCTTTGCCAACAATCAAA
CGAATAGTTGAAGCTGCTGTGGAAAAAGAAGGCCGCATGGGTGCTTCCTTACTTCGTCTCCACTTCCATGATTGTTTTGTTCAA
GTACGCATATTAACCCTAATTAACTTAACTGCTAAA
CATTTTCTTTATCGTTCTCACATCGTCGATTGTGTTTTAATTCTTGTATACATGTTCTTTGTGATCTATATATAGGGTTGTGATGCCTCCATTCTTCTTGATGACACGTCCACCATTGAT
AGTGAAAAGAATGCAATTCCAAATAATAATTCCGTTAGAGGATTCGAGGTCATCGACCTGATAAAGAAAGAGCTCGACAAAGTTTGCAAACGCCCAGTTGTTTCTTGTGCAGATATCTTG
GCTGTAGCAGCTCGCGATTCTGTTGTTGCT
GTGAGTAGTTAAATTTCCCTCTAATCTTTGTTCAATCATAGGTCCGATTGAGATTGGTTTTAGAAGACTTAAAAGTGATTTTGAAAAGTT
AAAAATACTTTTAAAAAATATTTTAATGTTTGATAAATTCTTTCAAAAAATTATTTTTGTCAAAATTACCCCATCATCATTTTATGTTTAATACAATATCATATATATCTTTATATATAT
TATAAAAATCTAAAATCAATAACTTCAGAGAGATTATTAATATTGCCAATTATATTGAGATAACAAAATAAAAAATAAAATTAATATTATAAAAAAAATGTTAGTTATCAATTATTATAT
ATACACAAAAAAAATTATACACATTCTTATAAATGTGTAAATAAATTTTATTTAATATTATTTTCAATTCATTCATTTACATTCTAACAGTAGTTTAATTGTAAGATTTACCAAACACAT
ATGAGTGCTTTTAAAATTCACAACACTTTTGAAAATAAATTTTATCGAATATTTAACTGATTATCTTCACAGCTGATTATTTTTATAGTACAACTAATGGCAATTATTTTAAAAGATATA
ATATTACTAAACTAACCTTTAATGTTCAGTGTTCACATAATAAATTGCATGCAATAACACGTATGAAAGCTTATGTAAGACAAGACTCTATTTGTATTATTAAAGACACAGTTTTTAAAG
TATTTGATAAACACTCATATTTATGATTCCCAGGCTAAAGGGATTATGTTTTGATAAAATCTTATAATAGTTTTACTATTTATTTTATAAAAATTATTTTAATTTTTACCGAACACAATG
ACATATTTCACAATGATTGTGTACCACTCTAAAAACTGTCTTTAATAATACAGATAGAGTCTTGTCTTACATAAGCTTTCATACGTGTTATTACATGCAATTTATTATGTGAACATTAAG
GATTAGTTTGGTAATACTATTTGATAAACACTCATATTTTATGATTCCTAGACTAAAGGAATTGTGTTTTGATAAAATCTTATAATACTTTTACTAGGAAAAATTATTTTAATTTTTACC
GAACACAATGACATATTTCACAATGATCGTGTACCCCGATACTTAACCATGCCCTTTCATGAATTTGGGCTAATTGTGTTTTACAAATTTGCAGCTAGGAGGACCAACATGGAAGGTGCC
TCTAGGGAGAAGAGACTCAACAACAGCAAACAGAACCCTAGCCAACAATGACATCCCATCGCCATTCCTCAACCTCACTGGATTAATCAGCAGCTTCAGAAGACAAGGCCTTAACGAGAC
GGACCTAGTGGCTCTCTCCGGTGGCCACACTATTGGCTTTGCTCGGTGCAGTGCCTTTCGAAACCGCATATACAACGCAACAAACATCGACCCCGACTTTGCTAAAGAGCGCCAAAGGAC
TTGCCCGAGCACAGGAGGAGACTCGAACCTCGCACCTTTTGACCCAACGCCATTAACCTTCGATGGCAAATATTTTTCTAGTCTGTTGCAGAAACGAGGGCTACTTATCTCAGATCAAGC
ACTTTTCAATGGGGGCTCAACCGATGGGCTTGTTAAAACTTATAGCCTTAATTTCAAAGCCTTCTCTGCTGATTTTGCAAACTCTATGATCAAGATGGGGAACATTAACGTTTTGACAGG
GAATAAAGGTCAAATTCGTTCGAACTGCAGGAGGCTGAACAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTATAGAGGCATATTTCATGTCGTTCTCATTTTGGCTTTTGCAGCTACAGCTTTCTCAACCCTTTCTCCTTGCTACTATGATAAAGTTTGTCCCGAAGCTTTGCCAACAATCAAA
CGAATAGTTGAAGCTGCTGTGGAAAAAGAAGGCCGCATGGGTGCTTCCTTACTTCGTCTCCACTTCCATGATTGTTTTGTTCAA
GGTTGTGATGCCTCCATTCTTCTTGATGACACGTCC
ACCATTGATAGTGAAAAGAATGCAATTCCAAATAATAATTCCGTTAGAGGATTCGAGGTCATCGACCTGATAAAGAAAGAGCTCGACAAAGTTTGCAAACGCCCAGTTGTTTCTTGTGCA
GATATCTTGGCTGTAGCAGCTCGCGATTCTGTTGTTGCT
CTAGGAGGACCAACATGGAAGGTGCCTCTAGGGAGAAGAGACTCAACAACAGCAAACAGAACCCTAGCCAACAATGACATC
CCATCGCCATTCCTCAACCTCACTGGATTAATCAGCAGCTTCAGAAGACAAGGCCTTAACGAGACGGACCTAGTGGCTCTCTCCGGTGGCCACACTATTGGCTTTGCTCGGTGCAGTGCC
TTTCGAAACCGCATATACAACGCAACAAACATCGACCCCGACTTTGCTAAAGAGCGCCAAAGGACTTGCCCGAGCACAGGAGGAGACTCGAACCTCGCACCTTTTGACCCAACGCCATTA
ACCTTCGATGGCAAATATTTTTCTAGTCTGTTGCAGAAACGAGGGCTACTTATCTCAGATCAAGCACTTTTCAATGGGGGCTCAACCGATGGGCTTGTTAAAACTTATAGCCTTAATTTC
AAAGCCTTCTCTGCTGATTTTGCAAACTCTATGATCAAGATGGGGAACATTAACGTTTTGACAGGGAATAAAGGTCAAATTCGTTCGAACTGCAGGAGGCTGAACAACTAA

Retrieve as FASTA