Entry information : Pret2CysPrx04
Entry ID 13822
Creation 2016-06-27 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-06-28 (Christophe Dunand)
Peroxidase information: Pret2CysPrx04
Name Pret2CysPrx04
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pret2CysPrx04
start..stop
S start..stop
Dr2CysPrx03 390 1.2e-139 1..248 1..250
Mmul2CysPrx03 374 5.57e-133 1..248 1..255
Mfa2CysPrx03 373 1.7e-132 1..248 1..255
Pabe2CysPrx03 372 2.67e-132 1..248 1..255
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13822' 'join(1..36,821..932,1584..1725,1861..1996,2079..2182,3291..3456,5153..5203)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..36 34 N° 2 821..932 110 N° 3 1584..1725 140 N° 4 1861..1996 134
N° 5 2079..2182 102 N° 6 3291..3456 164 N° 7 5153..5203 49  
join(1..36,821..932,1584..1725,1861..1996,2079..2182,3291..3456,5153..5203)


exon

Literature and cross-references Pret2CysPrx04
Cluster/Prediction ref. Genebank:   103477136
Protein sequence: Pret2CysPrx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   248
PWM (Da):   %s   26577.87  
PI (pH):   %s   8.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATVGRLLRTSVQVAAGGLKVAAACQHGVGGAARVLSAPVLQKSFFSTGSSRWAAAVTQPAPGFKATAVHNGEFKDLSLADFKGKYLVLFFYPLDFTFVCPTEIISFSDKAKEFHDVNC
EVVGVSVDSHFTHLAWINTPR
AGGLGNIHIPLLSDLNKQISRDYGVLLDGPGIALRGLFIIDPNGVVKHMSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPASWTPKSPIKPTPEGSKE
YFEKVN*

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
CCGTTCCCAC CGCCGTCAGG TGAAAATCAC ACAAAATAAA AAGCTTCTTA GTTTACCGGT AAATCTGTTC GACAAACTCC TGGCTTTGAC TTGTCTGGAC CGGTTTGTGT TTCTGTTTAT  CGACTGTATG AAGATAATAA AAATCACGCT GAGTAACCCC TGTACATAAA CATGTTTATT TTCTTTTTAC AGCAAGTTAA TATGCAGGTT CAAAATGTCT GACAGTGGTA CACAACATGA  AGTGCCAAAA ATCAACCGAA GTGGGAGAGA ACTGGAAATT AGAAAAAAAA GGCATTTGCC ACTTCTCATA CAAGTAGGGT ACATACTGTA TTTACACAAA GTAGGGAGAA ACACTCTGCA  GCACAGTGTG GTGATGGAAA CATCTAGTTT TAGGTGTACA TAAACTTTAC TTTGTACAGT AGCAGAAACG ACGCGCCGCC TCGTTCCTGC AGATAAACGG TGTTTTTCTT TTTAGCTTAC  CGAAAGACGT GGGCCCTCTT TAAAGCTTTG AATTCCAAAT AAAAAACGTC CCCCAAAAGA AAAGCGGGTC AAAATGTGGC TTCAGGAGTA CGAAACAGAA AAAAAAATGG AGGCAGAATT  TGATGAAGGT GGTTAATGTG GAAAAAACTT CATGCAGTTT CAGGCAAGCT GTAACAGCGC CCACCCCAAG CACCGAACTA AGAGGAAAAC AAATCAATGC AACTAAAGGA TTCATTTAAA  AAAAAAAAAC ACCCTGTAGT AAAACTGTAC AACGAAAATA CATTTGGGAT CTACATCTAA AGGTACATTA TTAAGGTTAT ATACACGCCA CCCCATCCAT ATATTATCTT TACATGTAGA  CTTCATTCAA CCCAAACATT TAGAAAACAA GACTAACTTG GAGATGGGAT CACATCAAAC GGCCATTAAA AACAAACAAA AGAAGAAAAT CAGTTCTTCC TGCACCTCAG CTGCTGATCC  GTTCCTGTCC AGTTCAGAAA CCCGACAGCT GGTCAGAACC TCACCGACTG GATGGACTGC TTCTGGAGAA TTAAGCCACC AAACGGAGGG TGGCGGCGGG TTTTTGTTGT TTTCAGTGAA  AGTAAAAGAA CAAACTACGG TACGGCGGAG AGACGACGAC ACTGCGAGTG ACTTCCAGGA ATACAAAATA GAAACGAACC CGGCTCCCGT GTAATCCGAC GCAACAGAAC CAAGGCTTTC  CGAACGCTCC GGCCTCTTCA CTGAAGAGAG CTACGCTACT CCGTCAACGT GTCGTCTCGT TTGGGACTGG CTCGGGGGGG AAAAGAGAGA AAAGTCGGCT TTAAACATTC AACCCCCCCA  ACCTTCTCCT AAAGCAACTG ATTAAAAAAT AAAAACCTCG AGTTTTACAT CTCCTCCACA GACTTCCCCC TCTTAAAGTC ACGGTGTTGA AATTTATTCA GAAAAAAAAC CCAAAAAACA  AAACAATGTT GAACAAAGTG AGATTCTCAC AATCTCTCTG CAAGAGGGAA GGGAATAAAT GACTTGTGCC TGCCGTCTTC CAGAACACGA AGGTGGATCA GTCAAATCCC CGTGTTGCCG  CTACGCTGCT TAGTCGATTT TCACGTTTGT GTAGATCTTC CTCACGAAGG CACTTGTTCC CATGTAGCCG ACGGCGCCTG GAAACAGATT GAATTAAGCG GGTCGGTTCT GCAGAGGAGC  TCTAGGAAAT GTCTGAGCAG CAGTCGGACC CGGAGAGCCC AGAAGGCAAA AAAACACCTG ATTGACATCA AACACTTTTT GAAACGGGGG TTGTGTGGAG TATGTCTGAG TGGGCATTAG  GCAGAGATAT TTAAAATCAA ACCTGTCGCA CCGATTAAAG AGCAGAAGAA GAGTTTGTTC TGAATGTATG GAGTACAGAC TAAAACAGTG ACGACCCTCC CCCACTTGTT GCTGCTTACT 
GCTGGTCAGC TGGCTAAATG CAGGATTCTT GAGATTTTCC TTGCTCATGA GAAAAATTTA CCATTTCAAT AACAGTAACT A 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
TTTCAGTATT TCAGCCTGAG GACAGCAGAG AGAGCAGATC ATTACGACCA GGCCAACACC GGAGCAGAAC TCCATGGTTA CTGTTAAACC TCACATTAGA GGAGAGCAGC AGGGATGGAT  CCAGGAGACA AACCCACGTC CTCAACCTGC TGAGGAAAGA CTGGAAAACG AAACGGGTTC AGTGCAACAA CCATTAATGA TCTGCGTGTT TAATCACTGC GGTTGAACTG TTACCTGGCC  TTGGTTTTTC CACTGCAGCA GATTAGCATC CATAACGAAC AAAAAAATAA AAGTTTACAG AAATTAAAGT AAAACAACCC ACTGAAAAGT AATCCTAAAA GCATGCCTTT CTCATGCTGC  TGAGGTCAAG ATGTTTAAAA CGAGACTTCC GTTTTAGTCA CGTGATCAGC GTTGTGGGTT GGTACGTTCA AGACGCATTT AAAAAATAGG AAATAACAGA GATATGAAAT GTTTTATTTT  TAGATCACAC ACTCCAGTTC AATACATCAA TAAGTTGTTA AATAATTAGG TAAAATTGAT ATAATTTAAA TAAAACTGGA AAAATGCTAC ATCTATTAGT TAAATTAAGA CATTCAAACA  TTTAAATAGT TTATTAGATG TATAATAAAA CGAGAAAAAA ATGGTAAATC CACATTTGTT TATTTCATAG TCCTGTTTGA CAGTAAGTCA CGAATTAATT TAATATCCAT CATAGTCGGT  GGTAACAATA TGATTAATCC TGACTTCAAC ATATACGCCC CTCTCAATAT GGCGTCGACG TTGACGTACG AAGTTCTGAA GAGCACCTGA AGGCAACATA ACCGACAGAC GCCCTTATTT  TATTCTTTGG GAAATACTTA TTTCGTGTTA AATCCTTTAC TGAAATATCA TTTTTCAAAG TGTAACAAAG AATATTTATT TATTTCATTT TACTGATTTG AATGACTGAT TTGTGTCCCG 
CACGTGGCTC AGACCTCCCT CCTGTTGTGA CATAATCCAA C 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCCACCGTTGGCAGACTGCTCAGGACCTCTCTGTGAGTTAAACTCTTGATTTCTGTCAGCTTAGGCTGTTTGTTCGCTCTGTTTACCTCGGTTTGCAGCTCCGAAAGCAGGAAT
AAACTCATGTCAGAAGAAGTTTTTAATTAATTTGTTCAGAAACGTGTTAATGTGCTGCGTATATATCCAAATTTGACACGGTGTTTCCAACCACTGGTTCGCGGGCGCTCCATGCGAACA
TAAAAAAATAAAACCGTGTTCAATTTTATTTGTTAATTATTTGTAAATGTGCGCTATAATTATGTATTTTGGCTAAACTTTTGAAACAGTTGTGTTACTTCATTTGAGCAGCAATTAAAA
TAGTTTTCAAATGATGACAAGATCAAAATGAAGGTTAAAAACAAGGTCAAAAACAGTGGTTATTTATATTACTATATAAGATATTTGTCACAGATTTTCTATTTGTTAAAAGATGGCAAC
AAATTCGATAAAGTGAAGACATTTTGTCCCTCAATTTACATTGAAACTCATGAAAATTTGTTACCCAAAATCACAAAAAAATCATAGTTGTGTTTTCTTTTTTTGTATATGTTGACTATT
AAAATGTCAAATGCTCTTAACTGACTTATAATAAAGTTAAGATGTAAAAAAACAAACAAACAAAAAACAAGAAGGAAGTAAATAGTTGGCAGCTGGCAGCATAAATCCGTTGTAATCTGA
TTTACTTTTTTTCTTGTTCATTAGATGCATCCAAACTAAGAACCTCTTTTGTTCCAGTTCTTCAGTAATTTATATTTTTAAGTATTTCTTATTATCTTGTAGGTTCAGGTTGCAGCTGGA
GGGCTGAAAGTTGCAGCTGCTTGCCAGCATGGAGTTGGCGGCGCTGCCAGGGTCCTTTCTGCTCCGGTTCTCCAGAAATCCTTTTTCTCCACCG
CGGTACGTACCGCATCACTAACAACG
TCCAGGAGTCAATATTATTCTTTCTACTGCTGATGATCATTAATCAGGTTAATTGTTTTAGTCCTACAGATGAGATTAAACCAGAACTGTTTGTTTAAACCAAACACGGCTCTGTCAGGC
ACGGCGGTGGCAGGGTGATGATTTGGGATTGTTTTTCTTATTTTAGCTTTTAAATCAACCAAAAGCAGGAATTTACAACTGAATGGTGAATAAACAACTAGAGGATTTAATCATTTTACA
TCATTTAGATCTTTATTTCTCAACTGGTGTCAAACTACAGATTAAATTGTATTTTTCTTCCTGTAAAGTTTAGTTTATTTTTCAATCTTATAAAACAAAAAAAAAAAACAGAAGCAAAAT
TGTTTTAATTTAAAATAAATAAATATTAAAGAATATTTATTATAATTTACTAACTGTGTAAGATTTCATTTTCTCTGCTTCAAAAATATTTAACAAATTAAAATGTTTAGTTTTGCCTCT
TTTCACATCAAATAGTTGCTGATTTCTGCCATAAGGCGCCGTTTACAGACCAGCCTCTTACACTGATGTGTAAAGGAGAACAGAGAGAGCTGCTGGCCGAATCTCCAGACAAACAGAGTA
AGAATCGTTTGACGTTTTGTTTATCAGGCTCCTCCAGATGGGCGGCCGCCGTCACTCAGCCGGCGCCCGGCTTTAAGGCCACTGCTGTCCACAACGGGGAGTTCAAGGACCTGAGTCTGG
CGGACTTCAAGGGAAAATACCTCGTCCTTTTCTTCTACCCTCTGGACTT
TTGTGAGTATTTGTGAAAAAAAGCAAACTGGGATTTAAGATGTGAAGATGCAGAAATGGAGAGAACTGAAA
CAGTTTGTTATTATTGGTATTGGACTAAAGCGAAACCTTTAATTCCTGCGTTTTTGCTGTTTTCAGTACGTTCGTGTGTCCGACGGAGATCATCTCGTTCAGCGACAAGGCCAAGGAGTT
TCACGACGTCAACTGCGAGGTGGTGGGCGTGTCTGTGGATTCTCACTTCACCCACCTGGCCTGGATCAACACGCCACGAAAG
AGGTGCAAATGACTCTGAATACGCAGCGACTGCAGCGC
GTACGTGGATGAATATGTGTGTTAGCGGCTTTTATTGCCCTTCCAGGCTGGAGGTTTAGGAAACATCCACATCCCTCTGCTGTCGGACCTCAACAAGCAGATCTCCAGAGACTACGGGGT
TCTGCTGGACGGCCCGGGAATCGCACTGAG
AGGTGGGCTCACTGTATCCGGAGTTACACCTGTTAACATCTTTGACGTGTTTTGTTATCATATTCAAAGCCCTTAAATTGTTTCCTACAA
GCAGAAACGTCAACATATTTTGTGTGAGAGGCAAACTGTGAAGAGGAAGTAAAATTATATGTAGATTTTCAATTAAAAACACCCATAAATAAAGTCCAGTTTCCTTCAGAGGTGATTTGG
TCTGTAAATAGTCCAGCAGTGAGTAATTTAAACTCAGATGTACTGAGATTACAGAACAACTGGACAAGTCCAGATGTTCAGTGAACATTAGAGGAGGAGGAGTTTAAATCAGAGTAGCTT
ATAAAACAAAATCCCCAGTTTTTAACATCTGTTAAGTCTGTACTTTATTCATCCAAAGGGGAAAATAAATCAACAATTAATGAACTAATTAATTGATGAATATCAGCTTCAGTTTGTGCA
AAAGCAAACAACTTGACTTTGGTTCTATCTTCGTCTGAATGAAGTTTTTAAATGTAAATAAAGAAAAAAGAACATTTTTCAAATTGTAACCAATTTTGGTTTTTTATCTAGTGACTTTTT
CTGTTTCTTAAAATGAAATGACAGAAAAGTTTCAAAAACTTTTTATTTAAATCATTACGGTGTAGTATTAGAACCAGTGTGAATTGTGGTAAAAAAGTTTTAATACAAGAATAGTCATAA
TAATTAATATGAGAATAACATTAGAATAAACTTGTAATACTACTTTATTGTTGAAATGCTTTTTCTGAATTTTTTTTAGTGTGGCCTTAATACTCGTTATAAATACAAGATGTTTGGTCC
TGTGTCGGCTGTTATCACTTTATTTCCACCATTAAACTACAAATTTAATGGTGGAAATAAAAATCCAGATTTTCCAAAAAATTGCATCTTCAAAAACAGCAATTTTGAGGTTAAATTATG
GAAATGGGCCTGATAATGATGAGGACACTCTGGAAGAAACCGTCGCTGCGGCACCAACTCGAAAGTTAAAGTCTAAACAGTTTCATGTCCAGCATGTGTGGGGTCTGCAGAGTTGTGTTG
GTCTAAAATACCTCTCTTACCCATAGAAACATCCGATAATCTTGTGTTACATTGGTTTAGGGGCTTATTCATCATCGATCCAAACGGTGTGGTGAAGCACATGAGCGTCAACGACCTGCC
AGTGGGTCGGAGCGTAGAGGAGACGCTGCGCCTGGTCAAGGCCTTCCAGTTCGTCGAGACGCATGGAGAGGTTTGTCCAGCCAGCTGGACGCCGAAGTCGCCCACA
CAGTGAGTATCTCT
GGGGAAACTGCAGATCCCTACAGCACCTAAACACAACGCTGCCCGCAGGGGGAATACGGCAGGCCGTTTTAACATAAAATCAGTTTCACCACACTTACAAACCAGATATTTTAAATTGGC
TTATGAGTAAAAGTATTAGAAAGTTAAGATATCTCTAATTATGTTTTGACTTGTGTAAATGACAAATTTGCCCTCGAGTTGTATATTCAATAAAGTTCTGAAAGGCTTTTTGAAGATGCA
CCATTTTCAGCTTGGAAACGGGTCGACAGCGACTCTCTCAGCGGAAGTGAATAAGCAGAAACTTTTTGCAGATTTCTAAAATGGTCATTGTGGCATTTTCTGACAATTTTGTGCAAAAAA
AACCAAAATTGAACAGCTCCGTTACAACACGGCGCTCACGCAGTTCTTAATTCAGATTTCTAAAAATGTTATTTAGATGAGTTACGTTTACATCCACGTTATTTTATGTTGTAAGTATGG
AAATGACAAATCCAGTAATTTGAGTTATAATTATTATTCTTACTAGTCAGAATGTTAATGCGGCGAGCTTAAATTCAGATTCCTGAAAGTCAAAATACCTTTTTGGATATCCAGAATGTA
ATAAAAGTGATTTTATAATAAAATGGCCTGCCATTTTTCCGTCCTCTTTTGGATTAGATTAGCTTGGAGTCGAGGTCAAAGGTCGATCAGCCCGTCTGCTTCATGTTTGGATGGAGACTA
AAAGCTTTTAACTAACTAAGCTCATTACTTTACCTGAGCAAAGGTTACAGATCTGCTACAGTGTGACCTTCATGTTGGCCTCCTGCTGGAAGGAGGCCAACATGAAGTGGCCTCCAACGG
TTAAATTCGGAGTCCTGCTGGGATTTTTTTTACATTTTTTGCAATCAAAATTCCTGATTTTTATGGTGCTACTTTACAAATATGTTCAAGAAATTTTGCAATATTTTTTTCGCATTAAAT
GGTTACCAAATTCTACATAAAGAAGAAAAAAGACAGATTTTATTCCTTGAGGAACTGAAACGTCTCAATTTACACAATTTTCACAGAAGATAACTTTATCAAGTGAGGCAGCAGGTTTCT
AGAAGAAACACTGCCACCTGCTGGTGGGAGCTCATGGAGCGTCGTTGCAGTTGCAGTAAAAATTTGATTTATTTAACGTGTCAGAGAAAAAAATGTAGGCGCTAATTTTTCAGTCATATT
TTCACCATTTTATTCATCTATTTATAAAGATCAGAGTTCCAAACTAAATCTCTTATTCACAAGATATATTTAGCTGAAAACTAAATATTTAATTTTCAAACTAAACATTTAGCTCAGATC
TAAATATTTCGCAAGTTAATTATCTTCATTGACACTCAATATTTTTGACCATTTGTGTAAAATTCAATTATGCATTAGCGTTTAAAAAAAGAAGCTTTTTATGTGAATTTCAACAAATTA
TTGTTGAAATTCACATAATTTACCAAATTTCCACCAAATTTGAGAAAGAAAATAACCAGAAAAAGTGCAAAACGCGTTTTCTGGTTAGTTTTTCATAGTAAAAATTTTAAATTGTTATTT
ATAATGAGCTGCTCTGTTGCTTTGCAACAAGAAGGTCCTGGGTTTGAATCCCCAGCTGGATTTTGTTTCTGCTCTCATCAAGTGTTCGGTGAGAGCAGCATAACGTCGTCTCGTTCCTTT
TCAGATCAAACCAACCCCTGAAGGATCGAAGGAGTACTTTGAGAAAGTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCCACCGTTGGCAGACTGCTCAGGACCTCTGTTCAGGTTGCAGCTGGAGGGCTGAAAGTTGCAGCTGCTTGCCAGCATGGAGTTGGCGGCGCTGCCAGGGTCCTTTCTGCTCCG
GTTCTCCAGAAATCCTTTTTCTCCACCG
GCTCCTCCAGATGGGCGGCCGCCGTCACTCAGCCGGCGCCCGGCTTTAAGGCCACTGCTGTCCACAACGGGGAGTTCAAGGACCTGAGTCTG
GCGGACTTCAAGGGAAAATACCTCGTCCTTTTCTTCTACCCTCTGGACTT
TACGTTCGTGTGTCCGACGGAGATCATCTCGTTCAGCGACAAGGCCAAGGAGTTTCACGACGTCAACTGC
GAGGTGGTGGGCGTGTCTGTGGATTCTCACTTCACCCACCTGGCCTGGATCAACACGCCACGAAAG
GCTGGAGGTTTAGGAAACATCCACATCCCTCTGCTGTCGGACCTCAACAAGCAG
ATCTCCAGAGACTACGGGGTTCTGCTGGACGGCCCGGGAATCGCACTGAG
GGGCTTATTCATCATCGATCCAAACGGTGTGGTGAAGCACATGAGCGTCAACGACCTGCCAGTGGGTCGG
AGCGTAGAGGAGACGCTGCGCCTGGTCAAGGCCTTCCAGTTCGTCGAGACGCATGGAGAGGTTTGTCCAGCCAGCTGGACGCCGAAGTCGCCCACA
ATCAAACCAACCCCTGAAGGATCG
AAGGAGTACTTTGAGAAAGTCAACTAA

Retrieve as FASTA