Entry information : PretPrxV01
Entry ID 13823
Creation 2016-06-27 (Harold Duruflé)
Last sequence changes 2016-06-27 (Harold Duruflé)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-06-28 (Christophe Dunand)
Peroxidase information: PretPrxV01
Name PretPrxV01
Class Atypical 2-Cysteine peroxiredoxin (type V)    [Orthogroup: PrxV001]
Taxonomy Eukaryota Metazoa Chordata Actinopterygii Poeciliidae Poecilia
Organism Poecilia reticulata (guppy)    [TaxId: 8081 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PretPrxV01
start..stop
S start..stop
DrPrxV 254 8e-88 29..189 1..162
HsPrxV 244 2e-83 30..189 55..214
PtroPrxV 244 3e-83 30..189 55..214
GgoPrxV 244 3e-83 30..189 55..214
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..96 96 N° 2 1153..1287 135 N° 3 1386..1517 132 N° 4 1602..1640 39
N° 5 1721..1785 65 N° 6 2315..2417 103  
join(1..96,1153..1287,1386..1517,1602..1640,1721..1785,2315..2417)


exon

Literature and cross-references PretPrxV01
Cluster/Prediction ref. Genebank:   103476210
Protein sequence: PretPrxV01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   189
PWM (Da):   %s   19923.41  
PI (pH):   %s   8.76
Sequence 230
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFSITGSLLKTPRVLQCxRLLHCSPVTKMPIKVGEALPAVEVQEGEPGNKVSMDQLFKGKKGVLFAVPGAFTPGCSKTHLPGFVQQAQELRSKGIQEVACISVNDAFVMAAWGKEHGADGKVRMLADPTGAFAKAVDLLLDSDTIVQVLGNKRSKRYAMLVEDGVVKKINVEPDGTGLTCSLSNVLAEL

Retrieve as FASTA  
Remarks
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTCGCTGCTG TAGCTTTTTT AATCCAGCTC CTCTCCCGCA GATGCTCTGA AAGTTGTACA AACGAAGCTC RCCTCCTGCC GACTCGACCT CGGCTCTCTT CCCAAAGGCG GTTGAAAACG  CTGGTCGCAG GTGTCAGGAR GAAGGTGATT AATGCGCACA ATATTGACCC GAAGAGCAAT TTCTTGCACA ACCCATTAGC CTTTGTATAC TCCTACTTAA ATCTTAATAA ACGTCATTAT  TTTCCTCAAT GTGTGCCATC ATTTTATTTC TGGGTTTAGG TTTTAAAATA AAGAAAAAAG ATGAAACCTT TGAAAAAGGA GCATTGATCC ATTTTCTTCT ATGTGGAATA TAATTTGTGC  AGATTTATGT AACAAAAAAA AGAAAAAGCA CAGTTTCTAA TTTAATGACA AGAAAAATAG ATCTGCAAGG ATATTACTGG TACTTTTGGT GTCAAATTAA ATGCAGTTAT TCCATGAAAA  AGCTAAAACC TGCTTTTGAC ATTATATAGT TTGGAATATT TTTTTTAACC AGAGTTAGTA AAAGCCATTG TGGAAGGTCC AAAAGCCAGT TGTGGTTCTA GAGTGCAATT AATGTCGAAG  CAAATTATTT CTACATGATT TAAATTTACT GACTAATGTA TAAATCAAGG GACTGAATCC TTTAAAAGAC ATTCATAGAA ACAAAGGAGC CCCATTTGTT ACCAACATGA CAACAAAAAA  AGATATTCTA CAAAGAAATA GTTAAATATG ACATGAGTAA TGGTAATGTC GTAGAAAGAT GTCTGAAACT TCAACATAAC ACGAGGTAGA GATACATTGC TTTATAAGGT CCTGTCTTTC  CTGTCTCTCC AAGAATGCTG CAGTAAAGGG GAAAACAAAA AAAATCCTAA AGCAATTACT TTAGGCAATA ACACAACTAA CTCTTATTTT TCACATTCAT TTGATTTGAC TGTAATTTTT  TTTAAAAAGC AATTCATAAT ATATCTGCAA GCTCAAAATC AACAATACAT GCCTATGTTA ATGATGGCCC ACTGTCGAAG TCACGTCAAA AGCTTTTACA TTTTAATATA TTGCGCCTGC  CAGGTCATGC GCAGGGCAAA CAGTTCCCCT CAAAGTAATG ACGTGCTGGC GCGGGCGCAA TGCATTGTGG GTGCCGGTGG AAACAGAAAC CAAATAGCTG CTCAGTTACG GTTTCATTTA  TTTTGAACTG GACGCTGAAA GGTACGTTTT TCACGCTGCC ATATTCTCTA GCTGTAAATT TACTGTAAGC ATTACAGAGC GGTAGATTAT AGTAAGCAAC AAAGAGAAGG AAAACAAGCT  GAGAAACATT GTTGTTGTTG TTTTAGTCCT AAGGCGCCTT CAATTTGAGC TACATCATGT CAGAGTAGCG CTAATTTCAA ACATTGGAGC TTCCTCGGAG ATTTTTTAAT GGATTGCGCA  ATGTTTGGAA GTGGCTCGCA CCCTCTGGCC TTGCAGGATT TCTGGGTCAG AGGTTTTTTA ATGGAATGTG CAGCTAGCAG TGAAAGTCCG GTCATTGTGA CACAAATGTT GGGCGTTGCG  CGCCCATTTC ACGGCTTGTC TCTGGAGCGC GAGCTTTCTA GCAAATACAC GACAGATTTT CCACTGTGCT GAGACTAAAG TCCTTATTCT GGGTCAGGAA CGAACATAAC TAGCATTACG  TGAAGCTTGC AGTAAACTTT GCTCTTCATT TGATGTACAA CGCTGAAGTG TTTGCGTAAA CCTGATTAGA AAGGGCAATC AAAACAATCT TGATATCGAT TAAGCTCCGA TTACAGTTTA  AGACATTCTA GCTATTTGCT AGTTACTTAT TTCCTATATT ATTTACTCGA CTCAACGCGT GTTGGGAAGT ATTTCTTTTT AGATGGAGTT GAATACATTT GTGTTGCATA GCTGAAATAA 
TTTGGTGTAA AGAAATACCT TGTCATACCA GCAAAATAGT GTTGACCAAA AAAGCAGTTA AAAAGGTAGC TATATGGTTT T 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATGGTGGAA CCCTGTTCCT CAGGTACTAA ATGTTTCCTT TTTGTTAGTT TGGCATAATT AATCTGTGTG CTATGGCTTG TATTTTGAGA AGAGGAGTCA TACAGTGACT TATGAACTTT  TTCATGTTTT GTCATAGCTG ATGATCTTTG CAAAACGGCA AAAGCTCGAC CAGATTGGAT GCACAGTGTT TTGACCTTCA AGTCTCGCCA CAGACTCTCA ATTGGATTTA GGTTTGAACT  TGGAGCCACT TACTGTTCCA CTGTCGCTCA GGCTGAAAGC TGGGAAGGTG AACCTCTGCT CCAGCCTCTT GCATGCTTTC TGTCATAACT CCCCTGTTTT TAGCCGCATC GGTCTTACCA  TCACCTCTGA CCACTTTTCC TGTCTCTAAG TAAAACCTCC ACATAGCATG ATGCTACCAC CACCACCATG CTTCACAGTA ATGATTCTCT GTTTAGGATG ATAGTTGAAT TTTGGTCTCA  TCTGACCAGA GCACATTTCA ACTTGATTGC TATGCCCCCT GCTGTGATTG TAGGAAACTG CAGACTGCAG TACTTCACTT TCCTTTTGCC ACAGTTCCAT ATAAGCCAGT TTTGTGGTGT  GCGTGGCAAG TGGTTTTCTT CAGATGCCCA AACCTGAGCT GACAGGGCCA GCTGTGGATA CCATGGCAAC GTTCCCTTTA GCAGAGACTG CAGCTAAGGG ATAATTAGCT CTACAAACAA  ACCTGTATTA GCATCACTAT TAAACACTGA GGCTTATGGC TGCTACTAGC AGATGGCGCT GTGATGCAAA TTTAGCAGGC CTGAACCTGA AAGATAGGTT AAGTACTCAG ACAAACTCTG  GGTGGGACAC ATCCGCGGGC ATTTACTGTG TCTGTAAATA ACTAAGAGTG GCAGCGGAAT CAGTCTGACG TGCCTCTGAA CGCACCGTTG CATAATTCTC CAGTCGTGAC GCAATCCTCA 
ACGCTAGCCC CGGTTAGCTG CGCAGCTACA GCGGAGCCAT T 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTTTCCATCACGGGTTCTCTTCTTAAAACCCCCCGAGTCCTCCAGTGCGYCAGACTGCTGCACTGTTCTCCAGTCACCAAGATGCCGATTAAGGTAACAAACTTCCAGTTAGCGTTAG
CTTTGATTAACGCCCGTTGACCTTTAGCGAACGGGATAACAAGTATTGCCCTGCAAAAAAAAAAAAAAAAAAAATCAAAAATCTATGTACGTTGTTTTTGGGGTGTAGCTGTAGCTCGCG
CAGCTGTCACACTGTCGCCATGACAGCCGAATAGCGGATACTTCTCCGTTTGCTGTCATTCAGCAGCAAGTTATGCTCGACGTGGAGCTATCGACTGAAACCTAACATTTGGTAATAAAK
GGCCTCTTTAGTTAACACTACTTCCTTGTGACTATTTTTGAAATTATTTTACTCATTAAAAGATATTCCTGGTGCAGAACAGAAGGGATTTATTCACATACAAGTCTTTTCGCTCTTCAT
TCCCCTTCCTCATTCTCCCTTGTCATTGTGCTTGTGCTTGTGTGGAGGTGAAAWAATTATATGTGGATGAGTCAACCTGTRTTTTTCAACTTTAAACGTTTACGTTCGCTGCACACTTTG
AAAATGTCAAGAAAATTAATAAATTAATATATAATTTGAAAGTATGGTGATTTGTCTCCATCTCGTGGCCTTTAATSGGTATTTACGTATTTTGAAATAATCCAAATTTCTGTCAGTAAA
GATATTTATCTCACCAATAAAAGACAAACAGCTCCTTAGTATTCCATGTCAGATTCCGTGTAGTTTATTTATATAGTCTAGGTCATACAGGTTTAATATAGTTTCCATTATATCGAGTCC
ATTTGGGTCCAAATTGAGTTAACTTCATTCTCATACTATGAAATAGTCAAATGCAGATCCATCTTCCTTTGTGTTCAGATTAATCTGTGCTCCATAAATAGATTTATTTGAAAGCTGAGA
AATGAAAAGATTTTTTTTTTTTTTTTAACAAATCAAAAATGAAAACTTTGCTTAAATTCCAAAATAAATGCTACTAGCTGGTATGGGAAAAAAATAAAGTGAACATTTAAAAAAAAAAAA
AAAAAAAAAAAAACAAACTGCGTTGCTCTAGGACATTTTTTAATCGTCTTTCTTGTCCTGATCTCTGTCAGGTTGGTGAAGCTCTTCCTGCGGTGGAGGTCCAGGAGGGTGAACCAGGAA
ACAAAGTGTCCATGGATCAGCTGTTTAAGGGGAAAAAAGGAGTCCTCTTCGCTGTACCCGGAGCCTTTACCCCCGGCTGCTCTAAG
GTGAGACCCCCCCACCCCCACCGGTGACTCCGCT
TGCCCTCTCCTCCACACGCCGACCTTTTCATCACCCAGCCTCATTCTTTCACTGCTGCCCGCAGACTCACCTTCCAGGCTTCGTGCAGCAAGCCCAGGAGTTGAGGAGTAAAGGTATACA
GGAGGTGGCGTGCATCTCTGTCAATGATGCATTCGTCATGGCTGCATGGGGAAAGGAGCATGGAGCGGATGGAAAG
GTATACATTGGACAGAAATATGCAAAATGCATGCTTCGAGTGTG
GAGATGTGTCTATTTAATTGTTTTCTTTCTTTCTCTGTAGGTTCGAATGCTGGCTGATCCCACTGGTGCATTTGCAAAGGTAAAAAATAAAAGTCCCCTATATGTCAGTTTAGTTCAAAG
TCTTTGTACTCATCWGCTCTTCCTGTTTGTGCTCATTAGGCGGTCGACCTGCTGCTTGACAGCGATACGATTGTGCAGGTACTGGGCAACAAACGCTCCAAGAGGTAAGCATTGTTATAC
CTATGACTGTGGTTCTAAYGTCACAATTACAGTTTAATTTAGCTCTGAATGCTTCTGAACTTRAGGTTTCTCTATATTGTCTTAATAAGGTTGCATGTCCTTTACTGTTGTTCGTTATTT
TATTTTTTTTTACATTTTCTAATAAATAGTAATGCAAAGAAGTTGTTGAATTGGACCTAAAATGACAAAACAAATCAATAAAACCTCTGTTTTAGGAATTCAATGAAAGTCAACAAAGYG
AGGTTTWAAAAAAAATCYGATGTATCTTAGACTATGAGTGTAAGATACTCCTTACTTGACAAGTACAAGATGTATAAAGTTATAAATATAGCTAACCGCAAAACACTTAAAATGGTTGTA
TTTGTGAATGTACCGAAATAAATCTGGAAATTTGATTGACTTCAAAAATCGGAAGTTTTTAAAGCTGTAGTTGTAGTTGTTTTCAGAGATGGCTACTTGCTCGCTGTGCCGATTCCGATC
TAAATCCCTCGTATTCTGAATAATCYGTTTCAGATACGCAATGTTGGTGGAAGACGGAGTGGTGAAGAAGATCAACGTGGAGCCGGACGGCACTGGGCTGACCTGCAGCCTCTCCAACGT
TCTCGCCGAGCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTTTCCATCACGGGTTCTCTTCTTAAAACCCCCCGAGTCCTCCAGTGCGYCAGACTGCTGCACTGTTCTCCAGTCACCAAGATGCCGATTAAGGTTGGTGAAGCTCTTCCTGCGGTGG
AGGTCCAGGAGGGTGAACCAGGAAACAAAGTGTCCATGGATCAGCTGTTTAAGGGGAAAAAAGGAGTCCTCTTCGCTGTACCCGGAGCCTTTACCCCCGGCTGCTCTAAG
ACTCACCTTC
CAGGCTTCGTGCAGCAAGCCCAGGAGTTGAGGAGTAAAGGTATACAGGAGGTGGCGTGCATCTCTGTCAATGATGCATTCGTCATGGCTGCATGGGGAAAGGAGCATGGAGCGGATGGAA
AG
GTTCGAATGCTGGCTGATCCCACTGGTGCATTTGCAAAGGCGGTCGACCTGCTGCTTGACAGCGATACGATTGTGCAGGTACTGGGCAACAAACGCTCCAAGAGATACGCAATGTTGG
TGGAAGACGGAGTGGTGAAGAAGATCAACGTGGAGCCGGACGGCACTGGGCTGACCTGCAGCCTCTCCAACGTTCTCGCCGAGCTGTAG

Retrieve as FASTA