Entry information : CsAPx01 (orange1.1g024615m)
Entry ID 1383
Creation 2011-10-11 (Qiang LI)
Last sequence changes 2006-08-11 (Qiang LI)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsAPx01 (orange1.1g024615m)
Name (synonym) CsAPx01 (orange1.1g024615m)
Class Ascorbate peroxidase    [Orthogroup: APx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation Cytosolic
Tissue types Barks
Callus
Flowers
Fruits
Leaves
Meristems
Petioles
Seedlings
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsAPx01
start..stop
S start..stop
CppAPx01 516 0 1..250 1..250
CclAPx04 516 0 1..250 1..250
PtriAPx01 508 0 1..250 1..250
InAPx01 462 6.07e-168 1..250 1..250
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1383' 'join(1142906..1143024,1143102..1143276,1143387..1143452,1144266..1144314,1144399..1144484,1144608..1144687,1144831..1144933,1145055..1145113,1145233..1145248)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1142906..1143024 117 N° 2 1143102..1143276 173 N° 3 1143387..1143452 64 N° 4 1144266..1144314 47
N° 5 1144399..1144484 84 N° 6 1144608..1144687 78 N° 7 1144831..1144933 101 N° 8 1145055..1145113 57
N° 9 1145233..1145248 14  
join(1142906..1143024,1143102..1143276,1143387..1143452,1144266..1144314,1144399 ..1144484,1144608..1144687,1144831..1144933,1145055..1145113,1145233..1145248)


exon

Literature and cross-references CsAPx01 (orange1.1g024615m)
Literature Bausher,M., et al., An expressed sequence tag (EST) set from Citrus sinensis L. Osbeck whole seedlings and the implications of further perennial source investigations Plant Sci. 165, 415-422 (2003).
DNA ref. Phytozome 12:   scaffold00014 (1142906..1145248)
Cluster/Prediction ref. UniGene:   Csi.4046
Protein sequence: CsAPx01 (orange1.1g024615m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250 (1526)
PWM (Da):   %s   27481.86 (174465.3)  
PI (pH):   %s   5.91 (8.76) Peptide Signal:   %s   cut: 21 range:21-1546
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALS
GGHT
GRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKYADEDAFFADYAEAHLKLSELGFAEA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAATTACCCCACTGTTAGCGAGGATTACAAGAAGGCCGTGGAGAAATGCAAGAGGAAGCTCAGAGGCTTCATCGCTGAGAAGAACTGCGCTCCACTCATGCTCCGTATCGCG
CGTACGTGTACTCTCTCGTTATACGTATGTATTGAATATGTGTGGGTGTGAGATTGATTTTTTTTTTTAATTGTTCAGGTGGCACTCAGCTGGTACATATGATGTGAAGACCAAGACCGG
AGGTCCATTCGGAACCATGAGGCTCGCTGCTGAGCAGGCACACTCAGCCAACAACGGCCTCGATATTGCCGTTAGGCTTTTGGAGCCGTTCAAGGAGCAGTTCCCTACCATCTCCTACGC
TGACCTTTATCAG
AGGTACTGTATAAATTAATTTGTTAATATCAGACGGCGATCTTTGACTTTTCTGATGACCGATTTAAATTTGTTTAACCGATCTTTTTTGTTTATCATCGTGGATCA
TGTAGCTTGCTGGTGTTGTTGGCGTTGAGGTTACCGGTGGGCCCGATATCCCCTTCCACCCTGGAAGAGATATGTAAGTTATTATTATTCGCTATTATTTAATTAAATTTGATTTAATAT
TTTTTCTGTTGTTTCGAGGATGAAATCGATTTGTGAAATTGATCTTAGTAGCTTGTTTAATTGTTTTGCTTGATTTATGTAAATTAATGTTGAAACATTTATAGCTCATTTACTGATAAA
ATTGGCCTTATTTACTGTTTATTTATTTATTTATTTTAGTGAGTGTTACTCTGTTTTCTGGTCTTTGGCTTTCATTGTTCTGTGTAAAACTTTATTTGGTCGTTGGGTGAAAATTGAAAT
TAAAGGAAGCAGTATAGGAATGTGCATGCGATACTTTTCTAGTTTTTTTTAGCGACTGCACTTGGCTTGGAAGATGTTGATGAATTTGTGGAACTTTTTAGAAATAAGAAAGTTGTTTCA
TAACATAAAACTTGTGGCTTTTGAAATTGTGTTGCACAATCAAATTGCTACGATTGTCTATGCGGACTACCACAAGTTTTGTGTGACTCTGTGGATGGCCCTCCGTGGTTAAGTGGCTGG
GTAATGGATACTGAAGTTATTGCACTGTTGCTTTTTTCACTGTACTTTGGTTATCAAATAAAATATCAGCCACCCTTTTGATGTGACATTACACACGTCCAAGTTTACAACACTGTTTAT
TATAACATTGTATATTGAAATTATAACACTTAGCTAGTTTTTTTCCCCTTTTAGTTGTGATTTGCTCTATTTATCTATAAAATACTTATCTGTATGGTGTTTTTGATTACAAATCTTGTA
TTGTTGTGATTTTTTGCTACTGACAATGGCCGTCTCCTATTCTCAGGACAAGGCTGAGCCACCTCAAGAAGGCCGGCTTCCTGATGCTAAACAGGGGGTTTGTATTTTTTTTAAGGATCT
TATTAAATGAGCTGTTTTGTTGCTTCATCTTGGATGGCTTCTTTACATTTAATTGCTGCAGGTAATGATCACTTGAGGCAAGTCTTTGGTGCTCAGATGGGCCTCAGCGACAAGGATATT
GTTGCTCTCTCTGGTGGCCACACCCTG
TGGTTAGTGCTAAACTGTGAAGATTTGTTGCTTTCCTCATGTGCTGAAATAATGTGGTTGTGAAGTGTTAAATTGGCTGCATTGTTTATAGTC
TAATCAGCTTATTGGTTTGAATAACTTTGTAGGGAAGGTGCCACAAGGAGAGGTCTGGATTTGAGGGACCATGGACCCGCAACCCTCTCATTTTTGACAATTCCTACTTCACACGTATGT
GTCACTGGTCTCTTTGCCTGACATGTTCGGTTGTGTATTGTTTGAGTCTTTTTGCATGAATAGTAGTCTTACTTTAAAATGTTAAATGAGTCCGTAGTTTAGGGAGAAATTTGACCTTGA
GTGTGCATGAAAAATAGGGAGCTCTTGACTGGTGAGAAGGATGGTCTTCTGCAATTGCCATCCGACAAGGCCCTTCTGGATGACCCTGTTTTCCGCCCTCTTGTTGAGAAATATGCTGCG
CGGTGCGTATGCTTAATTTTTATACTTCCTCAATGGTATATTGTTATTCACTTTATGTTCTGTTGGTATTTTCAAATGAATGTACTCTGATGATTATTTTGGTTGCTTCTTATCACCTTT
CAGGATGAGGACGCTTTCTTCGCTGATTATGCTGAGGCTCATCTCAAGCTCTCTGAGCTAGGGGGTAAGATTCTTTTCACCTTTGCTGATTATGCTTATTTCAATTTTATTGTTTTTCCC
TCTCTTAAAAATCTTCCTAATGTTACAACTCAACTTATTGGGTGCGCCTGTTCTTTGTTGCAGATTTGCTGAAGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAATTACCCCACTGTTAGCGAGGATTACAAGAAGGCCGTGGAGAAATGCAAGAGGAAGCTCAGAGGCTTCATCGCTGAGAAGAACTGCGCTCCACTCATGCTCCGTATCGCG
TGGCACTCAGCTGGTACATATGATGTGAAGACCAAGACCGGAGGTCCATTCGGAACCATGAGGCTCGCTGCTGAGCAGGCACACTCAGCCAACAACGGCCTCGATATTGCCGTTAGGCTT
TTGGAGCCGTTCAAGGAGCAGTTCCCTACCATCTCCTACGCTGACCTTTATCAG
CTTGCTGGTGTTGTTGGCGTTGAGGTTACCGGTGGGCCCGATATCCCCTTCCACCCTGGAAGAGAT
GACAAGGCTGAGCCACCTCAAGAAGGCCGGCTTCCTGATGCTAAACAGGGTAATGATCACTTGAGGCAAGTCTTTGGTGCTCAGATGGGCCTCAGCGACAAGGATATTGTTGCTCTCTCT
GGTGGCCACACCCTG
GGAAGGTGCCACAAGGAGAGGTCTGGATTTGAGGGACCATGGACCCGCAACCCTCTCATTTTTGACAATTCCTACTTCACGGAGCTCTTGACTGGTGAGAAGGAT
GGTCTTCTGCAATTGCCATCCGACAAGGCCCTTCTGGATGACCCTGTTTTCCGCCCTCTTGTTGAGAAATATGCTGCG
GATGAGGACGCTTTCTTCGCTGATTATGCTGAGGCTCATCTC
AAGCTCTCTGAGCTAGG
ATTTGCTGAAGCCTAA

Retrieve as FASTA