Entry information : CsAPx01 (orange1.1g024615m)
Entry ID 1383
Creation 2011-10-11 (Qiang LI)
Last sequence changes 2006-08-11 (Qiang LI)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsAPx01 (orange1.1g024615m)
Name (synonym) CsAPx01 (orange1.1g024615m)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation Cytosolic
Tissue types Barks
Callus
Flowers
Fruits
Leaves
Meristems
Petioles
Seedlings
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsAPx01
start..stop
S start..stop
CppAPx01 516 0 1..250 1..250
CclAPx04 516 0 1..250 1..250
PtriAPx01 508 0 1..250 1..250
InAPx01 462 6e-168 1..250 1..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1142906..1143024 119 N° 2 1143102..1143276 175 N° 3 1143387..1143452 66 N° 4 1144266..1144314 49
N° 5 1144399..1144484 86 N° 6 1144608..1144687 80 N° 7 1144831..1144933 103 N° 8 1145055..1145113 59
N° 9 1145233..1145248 16  
join(1142906..1143024,1143102..1143276,1143387..1143452,1144266..1144314,1144399 ..1144484,1144608..1144687,1144831..1144933,1145055..1145113,1145233..1145248)


exon

Literature and cross-references CsAPx01 (orange1.1g024615m)
Literature Bausher,M., et al., An expressed sequence tag (EST) set from Citrus sinensis L. Osbeck whole seedlings and the implications of further perennial source investigations Plant Sci. 165, 415-422 (2003).
DNA ref. Phytozome 12:   scaffold00014 (1142906..1145248)
Cluster/Prediction ref. UniGene:   Csi.4046
Protein sequence: CsAPx01 (orange1.1g024615m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27481.86  
PI (pH):   %s   5.91
Sequence 291
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTRNPLIFDNSYFTELLTGEKDGLLQLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHLKLSELGFAEA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACGAAGAATTACCCCACTGTTAGCGAGGATTACAAGAAGGCCGTGGAGAAATGCAAGAGGAAGCTCAGAGGCTTCATCGCTGAGAAGAACTGCGCTCCACTCATGCTCCGTATCGCGT
ACGTGTACTCTCTCGTTATACGTATGTATTGAATATGTGTGGGTGTGAGATTGATTTTTTTTTTTAATTGTTCAGGTGGCACTCAGCTGGTACATATGATGTGAAGACCAAGACCGGAGG
TCCATTCGGAACCATGAGGCTCGCTGCTGAGCAGGCACACTCAGCCAACAACGGCCTCGATATTGCCGTTAGGCTTTTGGAGCCGTTCAAGGAGCAGTTCCCTACCATCTCCTACGCTGA
CCTTTATCAG
GTACTGTATAAATTAATTTGTTAATATCAGACGGCGATCTTTGACTTTTCTGATGACCGATTTAAATTTGTTTAACCGATCTTTTTTGTTTATCATCGTGGATCATGTAG

CTTGCTGGTGTTGTTGGCGTTGAGGTTACCGGTGGGCCCGATATCCCCTTCCACCCTGGAAGAGAT
GTAAGTTATTATTATTCGCTATTATTTAATTAAATTTGATTTAATATTTTTTCT
GTTGTTTCGAGGATGAAATCGATTTGTGAAATTGATCTTAGTAGCTTGTTTAATTGTTTTGCTTGATTTATGTAAATTAATGTTGAAACATTTATAGCTCATTTACTGATAAAATTGGCC
TTATTTACTGTTTATTTATTTATTTATTTTAGTGAGTGTTACTCTGTTTTCTGGTCTTTGGCTTTCATTGTTCTGTGTAAAACTTTATTTGGTCGTTGGGTGAAAATTGAAATTAAAGGA
AGCAGTATAGGAATGTGCATGCGATACTTTTCTAGTTTTTTTTAGCGACTGCACTTGGCTTGGAAGATGTTGATGAATTTGTGGAACTTTTTAGAAATAAGAAAGTTGTTTCATAACATA
AAACTTGTGGCTTTTGAAATTGTGTTGCACAATCAAATTGCTACGATTGTCTATGCGGACTACCACAAGTTTTGTGTGACTCTGTGGATGGCCCTCCGTGGTTAAGTGGCTGGGTAATGG
ATACTGAAGTTATTGCACTGTTGCTTTTTTCACTGTACTTTGGTTATCAAATAAAATATCAGCCACCCTTTTGATGTGACATTACACACGTCCAAGTTTACAACACTGTTTATTATAACA
TTGTATATTGAAATTATAACACTTAGCTAGTTTTTTTCCCCTTTTAGTTGTGATTTGCTCTATTTATCTATAAAATACTTATCTGTATGGTGTTTTTGATTACAAATCTTGTATTGTTGT
GATTTTTTGCTACTGACAATGGCCGTCTCCTATTCTCAGGACAAGGCTGAGCCACCTCAAGAAGGCCGGCTTCCTGATGCTAAACAGGGTTTGTATTTTTTTTAAGGATCTTATTAAATG
AGCTGTTTTGTTGCTTCATCTTGGATGGCTTCTTTACATTTAATTGCTGCAGGTAATGATCACTTGAGGCAAGTCTTTGGTGCTCAGATGGGCCTCAGCGACAAGGATATTGTTGCTCTC
TCTGGTGGCCACACCCTG
GTTAGTGCTAAACTGTGAAGATTTGTTGCTTTCCTCATGTGCTGAAATAATGTGGTTGTGAAGTGTTAAATTGGCTGCATTGTTTATAGTCTAATCAGCTTA
TTGGTTTGAATAACTTTGTAGGGAAGGTGCCACAAGGAGAGGTCTGGATTTGAGGGACCATGGACCCGCAACCCTCTCATTTTTGACAATTCCTACTTCACGTATGTGTCACTGGTCTCT
TTGCCTGACATGTTCGGTTGTGTATTGTTTGAGTCTTTTTGCATGAATAGTAGTCTTACTTTAAAATGTTAAATGAGTCCGTAGTTTAGGGAGAAATTTGACCTTGAGTGTGCATGAAAA
ATAGGGAGCTCTTGACTGGTGAGAAGGATGGTCTTCTGCAATTGCCATCCGACAAGGCCCTTCTGGATGACCCTGTTTTCCGCCCTCTTGTTGAGAAATATGCTGCGGTGCGTATGCTTA
ATTTTTATACTTCCTCAATGGTATATTGTTATTCACTTTATGTTCTGTTGGTATTTTCAAATGAATGTACTCTGATGATTATTTTGGTTGCTTCTTATCACCTTTCAGGATGAGGACGCT
TTCTTCGCTGATTATGCTGAGGCTCATCTCAAGCTCTCTGAGCTAGG
GTAAGATTCTTTTCACCTTTGCTGATTATGCTTATTTCAATTTTATTGTTTTTCCCTCTCTTAAAAATCTTCC
TAATGTTACAACTCAACTTATTGGGTGCGCCTGTTCTTTGTTGCAGATTTGCTGAAGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACGAAGAATTACCCCACTGTTAGCGAGGATTACAAGAAGGCCGTGGAGAAATGCAAGAGGAAGCTCAGAGGCTTCATCGCTGAGAAGAACTGCGCTCCACTCATGCTCCGTATCGCGT
GGCACTCAGCTGGTACATATGATGTGAAGACCAAGACCGGAGGTCCATTCGGAACCATGAGGCTCGCTGCTGAGCAGGCACACTCAGCCAACAACGGCCTCGATATTGCCGTTAGGCTTT
TGGAGCCGTTCAAGGAGCAGTTCCCTACCATCTCCTACGCTGACCTTTATCAG
CTTGCTGGTGTTGTTGGCGTTGAGGTTACCGGTGGGCCCGATATCCCCTTCCACCCTGGAAGAGATG
ACAAGGCTGAGCCACCTCAAGAAGGCCGGCTTCCTGATGCTAAACAGG
GTAATGATCACTTGAGGCAAGTCTTTGGTGCTCAGATGGGCCTCAGCGACAAGGATATTGTTGCTCTCTCTG
GTGGCCACACCCTG
GGAAGGTGCCACAAGGAGAGGTCTGGATTTGAGGGACCATGGACCCGCAACCCTCTCATTTTTGACAATTCCTACTTCACGGAGCTCTTGACTGGTGAGAAGGATG
GTCTTCTGCAATTGCCATCCGACAAGGCCCTTCTGGATGACCCTGTTTTCCGCCCTCTTGTTGAGAAATATGCTGCG
GATGAGGACGCTTTCTTCGCTGATTATGCTGAGGCTCATCTCA
AGCTCTCTGAGCTAGG
ATTTGCTGAAGCCTAA

Retrieve as FASTA