Entry information : KflKat05 (kfl00404_0100)
Entry ID 13849
Creation 2016-08-22 (Christophe Dunand)
Last sequence changes 2016-08-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-22 (Christophe Dunand)
Peroxidase information: KflKat05 (kfl00404_0100)
Name (synonym) KflKat05 (kfl00404_0100)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflKat05
start..stop
S start..stop
KflKat04 660 0 113..611 77..573
HaurKat01 517 1.03e-179 115..602 7..482
PpuKat02 501 1.71e-173 114..600 4..478
PfKat01_Pf5 499 1.15e-172 115..601 7..482
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13849' 'complement(join(44948..45244,45581..45718,46041..46115,46368..46430,46651..46770,47148..47282,47793..47900,48148..48255,48607..48721,48941..48986,49275..49398,49730..49843,50396..50715,51588..51717))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 51588..51717 128 N° 2 50396..50715 318 N° 3 49730..49843 112 N° 4 49275..49398 122
N° 5 48941..48986 44 N° 6 48607..48721 113 N° 7 48148..48255 106 N° 8 47793..47900 106
N° 9 47148..47282 133 N° 10 46651..46770 118 N° 11 46368..46430 61 N° 12 46041..46115 73
N° 13 45581..45718 136 N° 14 44948..45244 295  
complement(join(44948..45244,45581..45718,46041..46115,46368..46430,46651..46770 ,47148..47282,47793..47900,48148..48255,48607..48721,48941..48986,49275..49398,4 9730..49843,50396..50715,51588..51717))


exon

Literature and cross-references KflKat05 (kfl00404_0100)
Protein sequence: KflKat05 (kfl00404_0100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   630
PWM (Da):   %s   70473.94  
PI (pH):   %s   6.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSASSVRLSLSPCISALRSSSSYAGSAPLRQFGFPAIFSTSGKRYHATRAEGTMDRVKNAVGQGIESVKLAVQDPDVHEAASRPGTSLGTKMEKGLEKGAELAETTAKKINPDIMTTLDG
RPLGDNYNSISAGKQGPLLLTEDINLYEK
AALNRERVVPRVVHAKGVGAFGKFTVTNSDMAKYTEAKVFESGKSTEIFCRWSGVTAEHGNSDSVRDIRGFALKFYTEDGNWDLVGNNSPI
FFF
RDPVKFPDLVHSLMRDPRGLKSWVHRWDFWGLTPESVHVLWLFGDRGIPKSYRYMNGYGVHAFSMINKDKERVWVKYHFHSQQEIKNLTSEEGIDLSGKDPDFFNKDMINAIRSGEY
PKWKMHIQVMTEQQAEQLSHDPFDVTKVWSRHDFPLIE
VGELEFNRVPESYFQDVEQAAFAPANIVPGLGFSPDRLLQGRLFAYRDAHNHRLGINGFQLPVNQPRCPIHTYHRDGAFRMD
GNGG
MGPHYEPNSFGGPQPDPKYADPAIPINVTGPGMRYENHYGKDDFMHAKAMWEMFEPDEQERVIANMARSMKEGTEAGVNSEPVPELIQQINLYNFARVDEDLGNKLAAALGLDLKS
SMDVGRKTLEQLYSRQTAGTHKDLSPES*

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns). Similarity with bacteria and Cyanobacteria Kat. (recent LGT?)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCGTCCTCTGTTCGTTTAAGCCTCTCACCTTGCATCAGCGCTTTGAGGAGCAGCTCAAGTTACGCAGGAAGTGCGCCGCTGCGGCAATTCGGATTCCCTGCCATCTTCTCTACA
TCAGGAAAGA
GTGAGTGCGAGGGGGTCATGCACAGATTGATCGGATCCGCCCACATTATGTGCTTCCTTGCCTGTGCAAGGATTTTCGTCTATGTTTGCTGGTGCTGCTGTTGTTGAACC
TTTCATATTGGAGGGATGCCGCATGTCTCAGCTGAGGTTGCCTATTCTGAGTTTTTGTTCTGGGATGAACACACCATGTGACAGAAGGCAGTTGAAGGGGCAGATGAGGGTGTGAGCAAA
GGCCTTTCTCACCAGCTCACCTCCTCAACAAGGGTACCTGATGTAAAGTCTGGGAACACGTCCTTGTGGGGCAAGCAGATCTTTGGTGGTGGTGTCAGAAACAGCATCCTGAAAAATTGT
GTGGTGTCAGAAACAGCATTCTGAGAAGATTCACCCGCGTCAGAAACAGCATTTTGAGAAACTCATTTCGAAACTTGAGTTCAGTGTTAAAGTTAGTTTCCCACTTCGACCTGACAGCTT
TGGCAGTCAGAAGTCCATTTCGAGCCCTCAAAAATTCGTGTGAGTCCCCAGAAGACCAACCCGTTTTGTTGCCACACACGACAGTCGCAAGCAATTAGCTTTGCAGAAGAGGGCGAAAAC
AATGAGCAAGCATTCTGAACAGCTCCATCTTGTACCTAGGTGCAAGTGTTTCTGGGATAGTGAGATCCGTCTGGCACCATCTGGTCTTTCCTTCTTAAACTAACGCAAATTACCTACAAA
TTAATCGACAACAATCAAACAAGCACACCATGGCACCTTCCTTTCATTGCAGAATTGCAGGATTCGTTCACAAATTATGAACTTGCGTCCGGATGTCTACTATCGACTGCAATTCTTCCA
TTTCCACTTCCTGATAACACTTTCGGAATCCTTTTCTCGCAGGAGATACCACGCAACTAGAGCGGAGGGCACCATGGACAGGGTGAAGAACGCCGTGGGACAGGGCATCGAGTCGGTCAA
GCTGGCCGTGCAAGACCCAGATGTTCACGAAGCGGCCAGCCGCCCAGGAACTAGCCTGGGGACAAAGATGGAGAAGGGCCTGGAGAAGGGGGCCGAGCTGGCGGAGACCACTGCCAAGAA
GATCAATCCTGACATTATGACCACCCTGGACGGCCGTCCCCTTGGGGACAACTACAACAGCATCTCGGCGGGGAAGCAGGGGCCCCTGCTGCTGACAGAGGACATCAACCTGTACGAGAA
GAAC
GTGAGTTCCTTGCGAGCTTCTTCAGGTCGACATTTCGAACCGCTCAGAAGTTGCGGCTCAGAAATTGGTGGGAGTAAAGCCTGCATCTGTGAATGAATACTGTACCAGCTCTTCAT
CAACTTCCTCAGTTTTTTGCGCCTGCTAATCGAAGTCAGTCGAACTTGGTCGGTGGCTCGGTTTTTGGCAGCTGCTTAACTCAAGAGTCTAAATTCTTCGTCGAGTATACTTCCTTTTTT
GATTATTCAGCTTGTCCAGATCTTACTGTGTCGTCAGTGTATATCTTCATTTAAATAATGTCCTTCGATTGGTTCTGACAATCTTCCGTAGTGATTGTTGACAGGTCCATTTTGTCCCTA
CACACGGGATATTGTTTGTGTCTTCATTGGTGTGTCGCCATTGTTCAGTTGCAGGAGTGTCCTCTTTTGCGTCCGAGAATTTTGTGCTGCTATTTCACATTCGATCATTTCGTCGGTGAC
TGAACAGGTTTGCTCATTAGAAGGATTTGTGGGGCTGAAAGCGTATCTTATGGTCGTCACTCGTGCGTCTGCGCAGGCGCTGCCCTGAACAGGGAGCGTGTTGTACCGCGGGTCGTCCAC
GCTAAGGGCGTTGGAGCGTTCGGAAAGTTCACCGTGACCAACTCAGACATGGCCAAGTACACCGAAGCCAAG
GTAAGCTTCGTTTCGTTTCTCTCTTCTTCGCCGCAATCTTGATCTCGA
GAAGCGATGTTCAAATGCTGGTTCGTCGGTGTTAAAGACGCAACGCACAGGGGTTTGAAGTTTGTAAATGCCACAGGCTTATGTATTGGCGAAGCTCAATTGATGGTTAAAGTGACGTCG
TATTGAGTACTCTGGTAAGCACACACGTTGGTAGTTCGTTCCGAGGATCGAAAACGGGGCGTTTTCAGGGAAAGTTCTTCTCAAAGCTGACGGTCAGCTTCTTATCAAGCCGCTCGATTC
CCACCCTCACCAAGTTCGTTTTGCTCTCTTTTTTTCCTGGCAGGTGTCTTTGAGTCTGGCAAGTCGACTGAGATCTTCTGTCGGTGGAGTGGAGTCACTGCTGAGCACGGTAACTCGGAC
TCGGTCCGTGACATCAGGGGATTCGCCCTCAAGTTCTACACCGAGGACG
GTGAGCAAGAGGAAACCTTACTAGGAAGGTTTTGAAAGTTATAGAAGATTAAGGCCAAGGCGATGTCCAGC
TTAACGCCCTGCGAGTGCCGAAAGTCTAGAAGCTAAGTATTAAAGCGAGATTACTCTATGCTGGTTCACATTGGATTCTTTGTAGTATTCTCAGAAGTTCTTAATGTCACTCATGTTATC
ATTCTAGTTGGATAGAGTCACGTCAGCGCAGCATTTCATGTGTTGGTTTTACCCTTCGTGCATTTGTTCACTCACTGTTATCTGCCCTTGTCTGCAGGCGCAACTGGGATCTCGTTGGCA
ACAACTCCCCTATTTTCTTCTTCCG
GTGAGGACATATCACGCATGTGAAACTTCGCGTTAATCGCGATGCAAGTACGTTCAAAATGCTTGCTTGCCCAGAATATTGACGAGCGGACGATC
CCAGCACCTTCAGAACAGAATTCTATTGACGAGTTTGATATTCTCTGGTCCGTTGTCCAGACTCCATCAAGTCCGCAAGTTTCTGATCCAATCGGACCTAATGATGATTGCCGTCATGTT
TCAGGGGGACCCCGTGAAGTTCCCCGACCTGGTCCACTCGCTGATGCGCGACCCTCGCGGCCTCAAGTCGTGGGTGCACCGCTGGGACTTCTGGGGGCTGACCCCGGAGTCAGTCCACCA
G
GTACGCGGCCAATTCACCATTTGACCTCACTTCAAACACGGGGGGAGGTTCTGTGTATGGACTCTGTGTCGTTGTCTTTTCCTTTTTCCCCGTTTCCTTTTTCCACAAATTTGCTTCAC
CGCGATACTGGCACTTCTGAATGCAATACCGCGACGGTGTGCCCTTTCGTTACATCTTGATTCGGCTTTCTCCTTGAAACTGCTTCGTCTGTGAATGCCTCTCCTCGAAGCTTGGCCTTT
CCCTACAAACAAGGAAGCCGAGCCCATGAGCCAGAGGCCAACAAGTGTGATGGTCATGCTCTGTTGGGCATACGCAACGGGTTCCGATGCCGTGAGATCTTTGTCCTGCCAGGTGTGCTG
TGGCTGTTCGGGGACCGCGGTATTCCTAAGAGCTATCGGTACATGAACGGTTACGGAGTACACGCTTTCTCCATGATCAACAAGGACAAGGAGCGTGTCTGG
GTAAGCTTAATTTGAGCG
AGCAGCGTTCTCGTTTATCTGGACCATCAGGCATTGCGTATCCGTGGGGGTTGTCGGCAACCCATGTGTGTAATGTCGAGATGATGAGCAAGGTTTTCGTTTCCATCTTTATGATCGTAT
CCAAATCCCAAATGCTTGATAAGTCATTCAAAGGTTGTTCTCGAGCATGTAGGTCCTTTTTTATAGTAGGTCTTCCACACCACCGCATCCATTGCGTTCCATATTGCAGGTGTCAAGTAC
CACTTCCACAGTCAGCAGGAGATTAAGAATCTGACCTCCGAGGAGGGCATCGACTTGTCGGGCAAGGATCCCGACTTCTTCAACAAAGACATGATCAAT
GTAAGCAACGTTCGGTTGGCA
CCTATTTTTATATTGCCTGTGTCTTCCTTATCTTCCTAATGTCTTGCATATCTACTTATAGACTGGTGGTGTATCGATAGAAAGTTCTGAGATAGTACGCTCTCGTTCCCATATCTACTT
ATAGACTGGTGGTGTACCGATAGAAAGTGTTGAGATAATACGCTTTTGTTCCCCAAGCTTGGGAGTTCTATTGATTTGGAATGCGATTGGTGTAGCATCAGATGTGTCTGCCATATCCTT
TTTGCGCCGCAGATCGCGTTCATTTGGCAGCTAAAGAAGCATCTCTATTTTTCCAACTCATGCACAACTTGCCCCCCCGTTTCCCCACACCCCGTCCGGGCACTTTTGACATATTTGAAA
CGATTGCGGGTTGGTTCATTGCGCTCTGGCAGTTCTCTAGCAGGCGGGAATGCCTCAAGAATTCCTTTGTTAGAAGTGCTAATCGGTTCTCATCGGTTCCTGGAAGTAAAATCTGCTGGT
TTCTCGCAGGCGCCATTCGGTCGGGCGAGTACCCCAAGTGGAAGATGCACATCCAGGTGATGACGGAGCAACAGGCGGAGCAGCTGTCGCACGACCCCTTCGACGTCACCAAAGTCTGGA
GCCGCCACGACTTCCCGCTCATCGAG
GTACGAAAGGCAGCTTTAAGATCTGCTCAAGTTTAATGCTGCTAAAGAATCTTCCGCTGGAAAGGATCCGGTTGCAATGAGCTCTGCGAGTTCC
GGAGTCTTGAGAACGATTTTTGCCGGATTGCTTGGTGTGGGATTGGCAGGAACAGATTGCGTGAGGATTGGGATCTCTAGGGTGTTTAGTCACGATTCGGGGCGACAGATAACTGAAGTC
GACATGTTATGCGAAGTAAACATGTTTTAGCGAAGTAAACGTATCAGTTCAGGTCTGAAATCGGTTCTTAGGATTGATAAGCGGGTGCTTTCCGATACACCAATCCTGTTAGGGCGTCGA
TCTCTTGATTGTTACAGAATAACGAAGGTGTTTCTGTGCTTAGGTGTGGGTGAGCTCGAGTTCAACCGTGTCCCGGAGAGTTACTTCCAGGACGTCGAGCAGGCAGCTTTCGCCCCCGCC
AACATTGTTCCGGGGCTGGGCTTCTCCCCCGACCGACTCCTGCAG
GTGGGTAGCTTCGCTTTCACTATTACCGCTCTCGCGCTGAGTTGTTTTGACCAATCTTAGATCGATTCAAAGGCC
TCCGAATGTTCAGGGATGTCTTTCTCTGCACGCTGGCTGTTATCGCCGTCTCTCATATGAAATTCTTTCAGCTGCTTGCTTGGTGATGTCCGCAAGTTGGACCTTAATCTGTTGTACCTC
TTAACAGAACTGGTCTAATCTGCAGGGGGACGGCTCTTCGCCTACCGCGATGCACACAACCACCGTCTAGGCATCAACGGTTTCCAGCTGGTGAGAATTGCGCGGCAGTTCGCCCCGCTA
CACTGCAGTATTGTAGCCCCACCTATGGTTGCAGGGGCTTGCCAATCCACATTCTTTTCTTTTGATCCACAGTCTTTTTATCCTCTGTCAAGAGTTATCTTGAGAGGTATTCCGCAAGAT
ATGTTGCCTCTTTCTGGATTGCTTCTTTCCTGCACGTCTGTACGTTTCGTGTTTGGTCACGACGTACGAACTTTGAAATGCTCAACTCGCGTTGTGTTGCAGCCCCCGTGAACCAGCCGA
GGTGCCCCATCCACACCTACCACCGCGACGGAGCCTTCAGAATGGACGGCAACGGCGGG
GTAAGGCGTACACTTTGTGGATCAGGAATACTCAAAAGACTGCTTCGTGAATCTTTGGGAC
TTTTTCTTATAGGATATGGGGGTGTCTGGGTTATACAGAGAGTTACAGTAGTGATACTACGTTCTCTGAACGTGCTTCTTTTGTTGCCCGGTCAAGAGTAGAGGACTTCCTTCTGGTTGG
TAAATTTGGATAATTTGTCTCGTCGATCTTCCCCTCGAACAATCTTCTGACAGACGGTGGATCATTGATCTCGTCGACCTCCCCTCGGTCAATCTTCTGGCTCGATCTTGCACTCATTGC
TCGTTTTCGCGGCTTCCTCAGATATGGGTCCTCACTACGAGCCCAACAGCTTCGGCGGACCGCAGCCGGACCCCAAGTACGCCGACCCGGCGATCCCAATCAACGTGACCGGCCCGGGCA
TGCGCTACGAGAACCACTACGGCAAGGACGACTTCATGCAT
GTGAGTTGACAGAAACAATCCATTGTACGTCATTAAAAGTAGATGATTTTTCCATTCCTGCTGAGTTGTACGGGCGTCT
ACCCCCGGCTTTTATTGATGATGGTCACAAGTTGCTCGTGCACTGGGGAGTTGCTATTCTGGTCCAAGGTTCTGAATTTGGCCTTTCCGCATTTGGTCCGTAATGTTTAGTTCCACATTC
AGTGATACCCTCACCGTTTCTGCTTTGAAACCTGCGAGCGTTTTAAAGATTTTGACAAGAGTTCTGGAGCACCCCCTTCCACAAAAAATGCATTTTATGAAACGCAGTCTCAAATTGGAA
GCTACGTGTGTGCGCAGGCGCGAAGGCCATGTGGGAGATGTTCGAGCCGGACGAGCAGGAGCGTGTGATTGCGAACATGGCGCGCTCCATGAAGGAGGGTACCGAAGCCGGGGTAAACTC
GGAGCCGGTCCCCGAGCTGATTCAGCAGATCAACCTGTACAACTTTGCCCGGGTGGACGAAGACCTGGGCAACAAGCTGGCCGCGGCTTTGGGGCTGGACCTCAAGAGCTCGATGGATGT
CGGGAGGAAGACCCTGGAGCAGTTGTACAGCCGGCAGACGGCCGGGACCCACAAGGATTTGTCCCCCGAGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCGTCCTCTGTTCGTTTAAGCCTCTCACCTTGCATCAGCGCTTTGAGGAGCAGCTCAAGTTACGCAGGAAGTGCGCCGCTGCGGCAATTCGGATTCCCTGCCATCTTCTCTACA
TCAGGAAAGA
GATACCACGCAACTAGAGCGGAGGGCACCATGGACAGGGTGAAGAACGCCGTGGGACAGGGCATCGAGTCGGTCAAGCTGGCCGTGCAAGACCCAGATGTTCACGAAGCG
GCCAGCCGCCCAGGAACTAGCCTGGGGACAAAGATGGAGAAGGGCCTGGAGAAGGGGGCCGAGCTGGCGGAGACCACTGCCAAGAAGATCAATCCTGACATTATGACCACCCTGGACGGC
CGTCCCCTTGGGGACAACTACAACAGCATCTCGGCGGGGAAGCAGGGGCCCCTGCTGCTGACAGAGGACATCAACCTGTACGAGAAGAAC
GCTGCCCTGAACAGGGAGCGTGTTGTACCG
CGGGTCGTCCACGCTAAGGGCGTTGGAGCGTTCGGAAAGTTCACCGTGACCAACTCAGACATGGCCAAGTACACCGAAGCCAAG
GTCTTTGAGTCTGGCAAGTCGACTGAGATCTTCTGT
CGGTGGAGTGGAGTCACTGCTGAGCACGGTAACTCGGACTCGGTCCGTGACATCAGGGGATTCGCCCTCAAGTTCTACACCGAGGACG
GCAACTGGGATCTCGTTGGCAACAACTCCCCT
ATTTTCTTCTTCCG
GGACCCCGTGAAGTTCCCCGACCTGGTCCACTCGCTGATGCGCGACCCTCGCGGCCTCAAGTCGTGGGTGCACCGCTGGGACTTCTGGGGGCTGACCCCGGAGTCA
GTCCACCAG
GTGCTGTGGCTGTTCGGGGACCGCGGTATTCCTAAGAGCTATCGGTACATGAACGGTTACGGAGTACACGCTTTCTCCATGATCAACAAGGACAAGGAGCGTGTCTGGGTC
AAGTACCACTTCCACAGTCAGCAGGAGATTAAGAATCTGACCTCCGAGGAGGGCATCGACTTGTCGGGCAAGGATCCCGACTTCTTCAACAAAGACATGATCAAT
GCCATTCGGTCGGGC
GAGTACCCCAAGTGGAAGATGCACATCCAGGTGATGACGGAGCAACAGGCGGAGCAGCTGTCGCACGACCCCTTCGACGTCACCAAAGTCTGGAGCCGCCACGACTTCCCGCTCATCGAG
GTGGGTGAGCTCGAGTTCAACCGTGTCCCGGAGAGTTACTTCCAGGACGTCGAGCAGGCAGCTTTCGCCCCCGCCAACATTGTTCCGGGGCTGGGCTTCTCCCCCGACCGACTCCTGCAG
GGACGGCTCTTCGCCTACCGCGATGCACACAACCACCGTCTAGGCATCAACGGTTTCCAGCTGCCCGTGAACCAGCCGAGGTGCCCCATCCACACCTACCACCGCGACGGAGCCTTCAGA
ATGGACGGCAACGGCGGG
ATGGGTCCTCACTACGAGCCCAACAGCTTCGGCGGACCGCAGCCGGACCCCAAGTACGCCGACCCGGCGATCCCAATCAACGTGACCGGCCCGGGCATGCGC
TACGAGAACCACTACGGCAAGGACGACTTCATGCAT
GCGAAGGCCATGTGGGAGATGTTCGAGCCGGACGAGCAGGAGCGTGTGATTGCGAACATGGCGCGCTCCATGAAGGAGGGTACC
GAAGCCGGGGTAAACTCGGAGCCGGTCCCCGAGCTGATTCAGCAGATCAACCTGTACAACTTTGCCCGGGTGGACGAAGACCTGGGCAACAAGCTGGCCGCGGCTTTGGGGCTGGACCTC
AAGAGCTCGATGGATGTCGGGAGGAAGACCCTGGAGCAGTTGTACAGCCGGCAGACGGCCGGGACCCACAAGGATTTGTCCCCCGAGTCTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTGCATGCAG CTGGTCGTCT TCTGTCACAT GCATGCAGCT CCGTGCGGCG CCGGATGCTT TGGCAACGAG ATAAGAGCCC GGGGGGTATC AAGCACCACT GACAACAGCC CCCCCATGCG  GGGATGCAAT GCATGCGCAG AGAGACAAGC CAACATAATG TCTCCAGGAC GTGGAGGGCC ACGGCAGAGG GAGCAATGAC GAAAATCGTG AGCAAGCCGC GGGGCCGGCG GACGTGGTCT  GCCGCCTCAC TGGCGGTTAG AGGTCTGTCG ACTCTGCTGA TGCACTGCCT AGACAGGATT GCATGCAGCA CACAGGTGCA TGCTGATGCA TATCCTGCAA CAAAGGCAGC CGTTCCGTTC  GATCAGTGCT GGAAGATTGA AACGGACGAG CTTGATCGTT TTCCAGCTCC GAAGCTTGTC TGTCAACAGA GGAGCTCCCT CCTTCCTCGC TGGTTTGTCG AAGTTTCTCT GATTGCGGTT  TGACAGAGCT GAGATTCTGT CAACGAAGTA CCGTTGTCAA CGAAGTACCG TAGCCAAGAA ATCCGCCGCT TGGACGGATT TACGTGAGAG AGAACGACAA GTGCACAATG TCTGCGTCCT  CTGTTCGTTT AAGCCTCTCA CCTTGCATCA GCGCTTTGAG GAGCAGCTCA AGTTACGCAG GAAGTGCGCC GCTGCGGCAA TTCGGATTCC CTGCCATCTT CTCTACATCA GGAAAGAGAT  ACCACGCAAC TAGAGCGGAG GGCACCATGG ACAGGGTGAA GAACGCCGTG GGACAGGGCA TCGAGTCGGT CAAGCTGGCC GTGCAAGACC CAGATGTTCA CGAAGCGGCC AGCCGCCCAG  GAACTAGCCT GGGGACAAAG ATGGAGAAGG GCCTGGAGAA GGGGGCCGAG CTGGCGGAGA CCACTGCCAA GAAGATCAAT CCTGACATTA TGACCACCCT GGACGGCCGT CCCCTTGGGG  ACAACTACAA CAGCATCTCG GCGGGGAAGC AGGGGCCCCT GCTGCTGACA GAGGACATCA ACCTGTACGA GAAGAACGCT GCCCTGAACA GGGAGCGTGT TGTACCGCGG GTCGTCCACG  CTAAGGGCGT TGGAGCGTTC GGAAAGTTCA CCGTGACCAA CTCAGACATG GCCAAGTACA CCGAAGCCAA GGTCTTTGAG TCTGGCAAGT CGACTGAGAT CTTCTGTCGG TGGAGTGGAG  TCACTGCTGA GCACGGTAAC TCGGACTCGG TCCGTGACAT CAGGGGATTC GCCCTCAAGT TCTACACCGA GGACGGCAAC TGGGATCTCG TTGGCAACAA CTCCCCTATT TTCTTCTTCC  GGGACCCCGT GAAGTTCCCC GACCTGGTCC ACTCGCTGAT GCGCGACCCT CGCGGCCTCA AGTCGTGGGT GCACCGCTGG GACTTCTGGG GGCTGACCCC GGAGTCAGTC CACCAGGTGC  TGTGGCTGTT CGGGGACCGC GGTATTCCTA AGAGCTATCG GTACATGAAC GGTTACGGAG TACACGCTTT CTCCATGATC AACAAGGACA AGGAGCGTGT CTGGGTCAAG TACCACTTCC  ACAGTCAGCA GGAGATTAAG AATCTGACCT CCGAGGAGGG CATCGACTTG TCGGGCAAGG ATCCCGACTT CTTCAACAAA GACATGATCA ATGCCATTCG GTCGGGCGAG TACCCCAAGT  GGAAGATGCA CATCCAGGTG ATGACGGAGC AACAGGCGGA GCAGCTGTCG CACGACCCCT TCGACGTCAC CAAAGTCTGG AGCCGCCACG ACTTCCCGCT CATCGAGGTG GGTGAGCTCG  AGTTCAACCG TGTCCCGGAG AGTTACTTCC AGGACGTCGA GCAGGCAGCT TTCGCCCCCG CCAACATTGT TCCGGGGCTG GGCTTCTCCC CCGACCGACT CCTGCAGGGA CGGCTCTTCG  CCTACCGCGA TGCACACAAC CACCGTCTAG GCATCAACGG TTTCCAGCTG CCCGTGAACC AGCCGAGGTG CCCCATCCAC ACCTACCACC GCGACGGAGC CTTCAGAATG GACGGCAACG  GCGGGATGGG TCCTCACTAC GAGCCCAACA GCTTCGGCGG ACCGCAGCCG GACCCCAAGT ACGCCGACCC GGCGATCCCA ATCAACGTGA CCGGCCCGGG CATGCGCTAC GAGAACCACT  ACGGCAAGGA CGACTTCATG CATGCGAAGG CCATGTGGGA GATGTTCGAG CCGGACGAGC AGGAGCGTGT GATTGCGAAC ATGGCGCGCT CCATGAAGGA GGGTACCGAA GCCGGGGTAA  ACTCGGAGCC GGTCCCCGAG CTGATTCAGC AGATCAACCT GTACAACTTT GCCCGGGTGG ACGAAGACCT GGGCAACAAG CTGGCCGCGG CTTTGGGGCT GGACCTCAAG AGCTCGATGG  ATGTCGGGAG GAAGACCCTG GAGCAGTTGT ACAGCCGGCA GACGGCCGGG ACCCACAAGG ATTTGTCCCC CGAGTCTTAA ATTGAGTCGG TGAAGTTTGA TACGTGCAGA GTAAAGACCA  AACAAAGTTT TGGCCGTGCA TAAGCTAGCG CAAGCGAGGC AAGTCTAGAG GCAAATCTAG ATGCAATTTT GTCGTTCCAC AACTTAATAA TTGGCTTGGC TGAAATTTCC CGTAGATCAG  ATGTTATCTG CCCAAACTTG TACAGTTTGC CTTCGCCTGG ATAAGTGCGT CCTGCATAGA TTGTGAAGTG GCCGGCTTCT TGAACCTGGT GTCGGCTGAA CACTTATTAC CGGCACGATT 
TTGCAACAAA TAGACTCTAG GACTCTTGCA TGTCAAAGCA TCATTGCTTG AAAAGTCGAT TTCCA 

Retrieve as FASTA