1. Browse the Database
  2. View Redoxidase
Entry information : KflPrxII02 (kfl00034_0060)
Entry ID 13851
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-23 (Christophe Dunand)
Peroxidase information: KflPrxII02 (kfl00034_0060)
Name (synonym) KflPrxII02 (kfl00034_0060)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflPrxII02
start..stop		 S start..stop
CpslPrxII01 187 3.37e-61 1..159 70..231
HaPrxII05 180 2.85e-59 1..159 1..162
NtPrxII02a 180 2.97e-59 1..159 1..162
PpePrxII03 180 3.21e-59 1..159 1..162
Gene structure Fichier Exons►


exon

Literature and cross-references KflPrxII02 (kfl00034_0060)
Protein sequence: KflPrxII02 (kfl00034_0060)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   164
PWM (Da):   %s   17504  
PI (pH):   %s   5.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPLKVGDKLPDGTVKGLDMKDISIKELTSGKKVIIFGVPGAFTPVCSSQHLPGYIKKHDEIKSKGVDTIAILAPNDPFVMKAWAEQYPDSEGKILYLADGTMDYTKKLGFEVDLSGHGL
GVRLRRFSLLAEDGVVKELNLEESGGLTTSGADEMCTMLPMAGQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron)
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST