Entry information : KflPrxQ02 (kfl00014_0250)
Entry ID 13853
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-23 (Christophe Dunand)
Peroxidase information: KflPrxQ02 (kfl00014_0250)
Name (synonym) KflPrxQ02 (kfl00014_0250)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflPrxQ02
start..stop
S start..stop
GbPrxQ01 252 2.52e-85 87..239 70..222
PabPrxQ23 248 8.55e-84 87..239 67..219
SmPrxQ-2_31 244 6.17e-82 88..239 69..220
SmPrxQ-1_21 243 7.11e-82 88..239 69..220
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13853' 'complement(join(162285..162545,163568..163657,164703..164840,166124..166396))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 166124..166396 271 N° 2 164703..164840 136 N° 3 163568..163657 88 N° 4 162285..162545 259
complement(join(162285..162545,163568..163657,164703..164840,166124..166396))


exon

Literature and cross-references KflPrxQ02 (kfl00014_0250)
Protein sequence: KflPrxQ02 (kfl00014_0250)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   253
PWM (Da):   %s   26401.46  
PI (pH):   %s   8.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSILCATPLSASAALTANASRAQSGAAAGPSAVAALPLGRSRSTQKWGAAAGLRSSSFVANNVGARFEAVSRGLVARCAAGSAVTICKVSIGDEAPSFSLADQNGRTVSLSKFKGKP
VVLYFYPKDDTPGCTKQ
ACSFRDSYADFKKAGAEVVGISADSPESHKAFAEKYDLPFTLLSDEDNSVRQAFGIKGDFFGALPGRETYVLDKKGVVQLVFNNQFSPEKHVAETIKVIEEIK
ADQKGGLFANLFQ*

Retrieve as FASTA  
Remarks Complete sequece from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCTCTAGTATTCTGTGCGCGACCCCCCTCTCTGCAAGCGCAGCTCTCACCGCCAATGCTTCCCGCGCCCAGAGCGGCGCAGCCGCCGGGCCTTCCGCAGTAGCGGCACTCCCT
TTGGGGAGGTCCCGCTCCACCCAAAAGTGGGGGGCCGCAGCTGGCCTCAGGAGCTCCAGCTTTGTTGCCAACAACGTGGGGGCGCGCTTCGAGGCTGTGAGCAGGGGGTTGGTTGCAAGG
TGTGCGGCAGGATCAGCCGTGACCATTTGCAAG
GTAGGGATATGGAATGATTGGGCAGAGTGTTGGATGCATGATCTGGGCGTTAGACTGCTTGATTACTGTGATCTCGGTTTCAATGCA
GTGAAAGGGCCTTAGTGATAGCTTTTGCAAGTTTCATTTTCATGCTTAATCTTGTTGGGTTGACCACAGAGCTTTGAGGATCTCGAATACTGACAGCTTTTTGAGGGTTTCGATATGCAG
CTAGAGGGATTGTGAGCTAATGGATGTATTGTGCTTTCTGATGGAGCCTCTTGCAAAGTACCAAGATCACGGAGGGCCATTGTGCTGGAGTAGGGCCATTGAATTTTCAGTTGCAACCAT
CAAGTCAGTTGCAATACTTGAAATATGGAAATTTGACCAGGTTTAAGAGTGGATCCTCGGCTTCACCGCTGCAATGAGACATCCTTTCCACCAAGCGCACATCCAGCTGAAAGTGAAAAG
CCGGTGTCTCTTCTGCAGAATGCAGATGTAATGAACAGCATGGTCTTGGCACACGCAGATGTAATGCACAAGAATGGCCGCATGGAATCTCTTCTAAGTTTCTTTAGCAGGACAAACTGA
TCAGCTGGGGAAGTCTCTTGAAAAGAGCATAGAAGTGCTTCAGAAGTGCTTTACACAGTCGCGCATCACGGCAGGTTTCAAGCTGCTGTCCTAATACCCTCTGCCACCGAGGCAGCCTTC
TAACGCTGATGTGATTCACTACACAGCGATTGCCTTTTGAATCGTGTTGGAATGGTGTCAAACATCTCACTTCTGCTCTCATTGTCTTATCCCCACTTTACCTTTGAGATCATCACTTCC
CTGCTACAAGCATAGATTTGATGCGGCCGCATCTTGACGCTGATGGGGCTTTGAGTATAAATGTAAACAAGCCTGTCACCTAGGAGTTTTCATGCTGCAGAAGTTTCTGTGCATGCTGCA
AATGGAGCTAGAAGGTCGGCTTCACTGAATACTTTTCGCGGAAACGGGCTTTGGTAAGAGACTACCGGGACAGGTCTACAGGAGTTCAATGCTTTTTCCCTTGAAGCTTGACGTCATTAC
TTTTTCTTTCTTCCATCATGAGTTGCTGGCTTTTGCCGCGTGGCGATTCAGCCCAATCTCCACCGCTCCTGGAAGCAAAATTCCTGCAAGCATAGAAGCACAAAACCTCCCCAGTCGTGG
AAGCAAAGACTATTACAAGCATAACAGCGCAAATTTTCCCCGCTCCTGGAAGCAAATCTTTTACAAGCATAGAAGCACAAATCGAGCCAGTTCAAGAACTGTCACTTCTTGTCCAGGTGT
GTCCATCGGTGATGAAGCGCCCAGCTTCTCCCTCGCCGACCAGAACGGCCGCACCGTGAGCTTGAGCAAGTTCAAGGGCAAGCCGGTTGTGCTCTACTTCTACCCCAAGGACGACACACC
CGGATGCACCAAGCAG
GTGAGAAAACGGTCCGCTGATATTGCACCCATTGAAATCTGCCCGGATCTTTCGATAGACGGGATTGAGTAACGGGCGGTGATCTGGGGTGTTTTGGGCGCCTC
TTTGTCTTGTCTGAAAGTTCTTGTCTGCGATATGCAGAAAATGCGGGTGTTTGACTCGTTGATTCTGGTGTGTTAAGCTTTTGGGACTTTAGGTTCAGGATGGAAGGCACTTATGCTCCT
CATGAAAGTAAGTGGACCTGAAAGCGTGCATAGCTGGGCGACATGGGTTGTGACTTCGGAGAGTACATATACATCAGACACTGCAAAGACGATCGTTTTAAACGGGCAACTCACATTCAA
GTGAGGGTTGCCGAGATGGGGCTGTCGAAAGAACAGGAATTGGAAGGCTGTGTTGCAATGGATCGTTGCAGTAAGCTCCAAAGCAGATTCTCATCCACGTGGATTGGCAGCTCGAAGCTA
CATGGGACAGCTTAACCAAGTCGAACGTCAGCACCCATCTCCTTCGGCAGCGCTTAATGCCCTCTATAGGGCGAAGACTGACACCCGCCGATGTTTGCCGTGCCTGCAATCCCCTTCGAC
CCGCCTACATCAAAACACTAAGAAGAGACAACAGTGCGGTCTGGCGAAATTAACAGTGCGGTCTTTACTCCGTAATCAGGCTCTCATTCACGTTTCACAGACGATGCCAACCGGCCAAGA
CGCCAGCCGCTAAAGGGTAGCATATTCATAGTTCCACAGCCATGATTTGAAAGGCTTTTGACCGGACAACCACCCCTCGCACCTAGTTGCCGCCCCATGGGATCCGCAGCGTGTTCGAGG
ATTACGTGCCTCGTAAGCACGAATCGATTTTTTGGGCTAGTGCTCACGTCACTCGCGCGTTCCACACAAGCTGGATGTACGAACGGTTCGGGTTATGGCAAGCATTCAAAAGTTGGGACG
CGAGTCGACCAGCCAAAATACAGATTCGATCACCCGTCATTACACATCCAAATGTTTGCAGCGTCGTTCCTAGTTGTAGACCGTTTTATCTCCCACTGCAGGCGCCTGCTCGTTCCGTGA
CTCGTACGCCGACTTCAAGAAGGCCGGTGCGGAGGTAGTCGGCATCAGCGCAGACTCACCTGAGTCCCACAAG
GTGAGCACGGGGCGGCTCCGTTGCTAATTACATCGTTGAATACCTCG
TTTCTCAAAGTCGCGTTTTCGAACTGAAATTCGTTTAGGTGGAGTTCGAAAGCTGCCACTCGTGTTCTCTGGCGGGATTTCCTCAGCAGCTTCATCAGCTCCCACCTTGTCAAGTCGCTG
CTTCTTTTATGAAGTTCCTTGCGATCAGGCTTAGCTCACAAAGAGACTACGAAGAGAATACGAAGAGAATAGAAAAGACTACGTCTGTCACAAGGACGTTGCGCAGCCGCGAGACTCTGA
TGTCCAGCTTCCGCTCTTGCCGCCTGCCCGTCTCTCTTTCCGTGCTCCTTTTATGTTTGCGTCTGTGGTGGTCTTCTTAACTTTCTTCTTACCTACTCATTTCCTGATTGTCAGGCCTTT
CTCTGCACAACTATGCTCTGTGCTGCATGCTCCTGCCTGACGAGGACAAGTAGTAGCTCATCTCTTTGAAATAATGGATCCACCTTCTCTCTTGTGGAAATTCTCTCTTGTTGCCCTCGG
CCTTCGCCGAGGATTTCCTGTCCGGAGTTGCTCTCCCTCACTTAAATTGGCTCTCTTTTCCTTTTCAACCTGACATCCTTGGACAACTTTGCTCATTGTTCTTACGCTTTCGCTGAGAAG
CACAAGGTACCGTTAGCATCTTCAGACATTTATGCGTACGCAAATGTTTTACCTTCGTTTCTGCCTAACATCCCGAGAACGCCACCATTGTCCGTTGAGCCTTTGCCGACTGAAAAAGTG
CCCTCTACTCCTTTCTCTCTTGCTTCCATCGTCATTGTTCTTCAGGTTCTTTTTCATCACTGTTGCATTCCTATGTGTTGCTGCATTTCAAACCCATAGAACTCCCAAATCGTCCGCACG
TCTTTGCACAAGGTTAAATCTACCCGTGGTGCTTTGGCCCAACCAGGATCATCAGCAATCTCTCTTCGTCAGGTTGCTACTGCCGCCTTCCTTTATCTCTTTGTCAGCTCAAAAACTTCT
TGCTTTCTCCGTCAGGCGCCTTCGCCGAGAAGTACGACCTGCCCTTCACGCTCCTGTCCGACGAGGACAACTCCGTCCGTCAGGCGTTCGGCATCAAGGGCGACTTTTTCGGCGCGCTTC
CCGGGCGGGAGACGTACGTGCTGGACAAGAAGGGCGTCGTACAGCTGGTTTTCAACAACCAGTTTTCGCCGGAGAAGCACGTGGCGGAGACGATCAAGGTTATCGAGGAGATCAAGGCGG
ACCAAAAGGGCGGGCTCTTTGCTAACCTGTTCCAATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCTCTAGTATTCTGTGCGCGACCCCCCTCTCTGCAAGCGCAGCTCTCACCGCCAATGCTTCCCGCGCCCAGAGCGGCGCAGCCGCCGGGCCTTCCGCAGTAGCGGCACTCCCT
TTGGGGAGGTCCCGCTCCACCCAAAAGTGGGGGGCCGCAGCTGGCCTCAGGAGCTCCAGCTTTGTTGCCAACAACGTGGGGGCGCGCTTCGAGGCTGTGAGCAGGGGGTTGGTTGCAAGG
TGTGCGGCAGGATCAGCCGTGACCATTTGCAAG
GTGTCCATCGGTGATGAAGCGCCCAGCTTCTCCCTCGCCGACCAGAACGGCCGCACCGTGAGCTTGAGCAAGTTCAAGGGCAAGCCG
GTTGTGCTCTACTTCTACCCCAAGGACGACACACCCGGATGCACCAAGCAG
GCCTGCTCGTTCCGTGACTCGTACGCCGACTTCAAGAAGGCCGGTGCGGAGGTAGTCGGCATCAGCGCA
GACTCACCTGAGTCCCACAAG
GCCTTCGCCGAGAAGTACGACCTGCCCTTCACGCTCCTGTCCGACGAGGACAACTCCGTCCGTCAGGCGTTCGGCATCAAGGGCGACTTTTTCGGCGCG
CTTCCCGGGCGGGAGACGTACGTGCTGGACAAGAAGGGCGTCGTACAGCTGGTTTTCAACAACCAGTTTTCGCCGGAGAAGCACGTGGCGGAGACGATCAAGGTTATCGAGGAGATCAAG
GCGGACCAAAAGGGCGGGCTCTTTGCTAACCTGTTCCAATAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTTGCTGAG TGTTGGCTCC CACTTGCCCA CGTCCTTGTC TTTTCACTCG CCCTTCGCGG CCTCCTTTGA AAAGCTGCAT TGCAATCTGC AATGCGAACT TTCTGATCTG ATTGCTTCAA  CAAACTTTGC GCTCTTGCAA TTCAGAGCTT GTCTTCCTAG AACATCTTTG ACTGAGTACA ACCTTTCAAC AAGTTCCAAG AAGCGTAACC TTTACACCTG TTACAGTATT CAGGAGGGTC  CATCAGCGTA AAAGACGAAA AGAACCATCT ATAAGCCCGC AGCCTGCGAT CCATAAGAGA TGGCCTCCTC TAGTATTCTG TGCGCGACCC CCCTCTCTGC AAGCGCAGCT CTCACCGCCA  ATGCTTCCCG CGCCCAGAGC GGCGCAGCCG CCGGGCCTTC CGCAGTAGCG GCACTCCCTT TGGGGAGGTC CCGCTCCACC CAAAAGTGGG GGGCCGCAGC TGGCCTCAGG AGCTCCAGCT  TTGTTGCCAA CAACGTGGGG GCGCGCTTCG AGGCTGTGAG CAGGGGGTTG GTTGCAAGGT GTGCGGCAGG ATCAGCCGTG ACCATTTGCA AGGTGTCCAT CGGTGATGAA GCGCCCAGCT  TCTCCCTCGC CGACCAGAAC GGCCGCACCG TGAGCTTGAG CAAGTTCAAG GGCAAGCCGG TTGTGCTCTA CTTCTACCCC AAGGACGACA CACCCGGATG CACCAAGCAG GCCTGCTCGT  TCCGTGACTC GTACGCCGAC TTCAAGAAGG CCGGTGCGGA GGTAGTCGGC ATCAGCGCAG ACTCACCTGA GTCCCACAAG GCCTTCGCCG AGAAGTACGA CCTGCCCTTC ACGCTCCTGT  CCGACGAGGA CAACTCCGTC CGTCAGGCGT TCGGCATCAA GGGCGACTTT TTCGGCGCGC TTCCCGGGCG GGAGACGTAC GTGCTGGACA AGAAGGGCGT CGTACAGCTG GTTTTCAACA  ACCAGTTTTC GCCGGAGAAG CACGTGGCGG AGACGATCAA GGTTATCGAG GAGATCAAGG CGGACCAAAA GGGCGGGCTC TTTGCTAACC TGTTCCAATA GAGATGGATT TGCTGGCTGG  GCGCTTGTAT GAGAGCCATA ATAGAGGTAC GAGGACATAG TCGTATTTTG AAGGAATGAG CAGGTACGGT AGAAAGTTGC ACCGCTTTGT TGGTGCGTCG GACAGCTGGT CGCAGAGTAG  GATAAGTCAC AGACGGTAAC AGTTTTGCGA TGTACCCTTC TCATCATAAG GATATTTCGA TGCAGAACGG ACTTTCGATC TAACCGTCAC TTTCGTGCGC TCCCTGCACA GATGCGTCTT 
TAAAGCTCGG CAGCAGTGCA CACTCGGACG CTTCTTGTTA ATTATAATAG AACCAACCAA TCTGATAGAC AGGGCCCGAT TCGCGGTCGC AACTCGTTCT 

Retrieve as FASTA