Entry information : KflGPx03 (kfl00356_0110)
Entry ID 13857
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-23 (Christophe Dunand)
Peroxidase information: KflGPx03 (kfl00356_0110)
Name (synonym) KflGPx03 (kfl00356_0110)
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGPx03
start..stop
S start..stop
SpraGPx[P]03 162 3e-50 108..281 6..173
PtGPx02 91 1e-22 101..261 1..160
ThasGPx02 89 5e-22 101..261 1..160
PsGPx01 91 6e-22 96..267 66..236
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 60550..60628 79 N° 2 60880..61101 222 N° 3 61274..61390 117 N° 4 61543..61600 58
N° 5 61797..61831 35 N° 6 62109..62141 33 N° 7 62402..62457 56 N° 8 62672..62689 18
N° 9 62934..63020 87 N° 10 63567..63626 60 N° 11 63850..63887 38 N° 12 64119..64161 43
join(60550..60628,60880..61101,61274..61390,61543..61600,61797..61831,62109..621 41,62402..62457,62672..62689,62934..63020,63567..63626,63850..63887,64119..64161 )


exon

Literature and cross-references KflGPx03 (kfl00356_0110)
Protein sequence: KflGPx03 (kfl00356_0110)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   282
PWM (Da):   %s   31410.57  
PI (pH):   %s   11.31
Sequence 323
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAATCARLQPAILRGFESTKLSPVNGGPGQRQALAVPRRSRNSWSRLHSRCIRAAKAVVEPGPTADCSDQQRWTSNRFGPSRRELLVATTGGLIGLQTNVAEAQPKSLYGFTVKYKEEDLSLGKYKNMVRRTTSFSEIRFGRSQHSICVTPAKRELSGSSLLVQQVQRSGVRASCFPMQSVRRPGSRQQRRRTGLRILQFPVFDKIDVKGPAMSPVYDFLKSKQPGEIEWNYVKFLVDRNGVPVRRYKPGFDPVNFEEDLVATLAGRPLPPKQRVYLGAP*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGGCCGCCACCTGTGCGAGGCTGCAGCCAGCTATTCTGCGCGGCTTTGAAAGTACAAAGCTCTCTCCTGTGAATGGTGAGGCTGCGGTTAGTCAGGCATATGCATATGCATATTCTG
GTTGCGATACAGAGGAACAGTAGCTGCCATTGAGCAATACCCACTTTCCATATGGTGCACCTGACAGCTCACTTTCTGGTGGTCTGATATCCAACGCGGTTTCAAAACTCAGCAATGCTG
CGCAGAAGTGCTGGCGCATCTTCCTCGCTTGAAGAACTGAGTATGATTGGAAGTACTGCACTAACGCTTTGACGCCAACTCGCTTATAGGTGGCCCCGGCCAGCGGCAGGCACTCGCTGT
GCCCCGCAGGTCAAGGAACTCGTGGTCCAGACTGCATTCCAGATGCATCCGTGCAGCCAAGGCTGTTGTAGAACCTGGGCCAACGGCTGACTGCAGTGACCAACAAAGATGGACTTCCAA
CCGCTTCGGCCCCTCACGCAGGGAGCTTCTGGTCGCCACCACGGGAGGGCTGATTGGACTTCAAACAAATG
GTTGGAACTTGCCCCTCTGATGGTTGCTGGGCGCACCTCTTGATATGAT
CACTCCTGCTTAAGTGGGGGCCATTGCCCTGATGCTGAAAGAGATCATCGAAGAAAATGGAGTTTTTGAGGGGCATGCCCTATGTCGTTGCTGACATATGTCCCACTCCGTCGATTGGTG
CAGTTGCTGAAGCCCAACCAAAGTCGCTGTATGGATTCACCGTCAAGTACAAGGAGGAGGACCTTTCGTTGGGGAAATACAAGAACATGGTACGAAGAACAACGAGCTTTTCAGAGATTC
GTCAAGGACACTTTCTTGACCGGACACCCCATGTGTTATGAAATCTCAACCTTTGCCTGAAAGATGTGGGAGTTCCAAAAGAGAGGCTGCGACTGTATTCTTTCCTCTTGTTCAGGCCCG
CTACTTACAGCGCCTTGTCCTTGTCTGTGCAGGTTTCGGTCGTTCTCAACATAGCATCTGCGTGACCCCTGCAAAACGTGAACTATCCGGGTAGGCCATGCCTGGAAAGCAGGGGTACTG
TGGCTGCGCACTTCTTGTATTTGTATGTTAAACCTGGAAGTCTGGTTCACACAGAAGCTTGTGATGCTTCTTTTTTGTAGACTTGGAATGAACTTTCCACCAGGGGACGTCGCGTGGCTT
AGTTTGAGGTAACCACAGGTTCTCAGCCAATGTTTCTCCTTGCCAGGTCTTCGCTACTTGTTCAACAAGTACAAAGATCAGGTATGGAAACCCAACACAACATGCAACTTGAGTTCAGAG
TATTCATGGCCATTCAAAATTCACCAGCTTCTTGGTGGATGGGTGTCACAAGAGGGGCAGGGGCGTTCTCAAGCAGCCGAACGTATCCCAAGACTCGTAACTTGTCATTGTCTTTGGACC
CTCATTCAGCGTGTTTGGTCAATCTAGTAAACAGGGACGAGTGGTGCCGTTTGTTAGGCCCTTGCACGGCCTGTTTTATATCTATACCATTTTTAAGCAGTGGTGCATCGGCCTGCAGGG
GTTCGCGCTTCTTGCTTTCCCATGCAATCAG
GTACGATCGAACACCTGTATTGTCTTTTAGTGACGAACAGATCCGTTGGCACTAAAAGGAGGTTCTGGCATTTGAATCAGCATAAGACT
CTGTTCCCAAAACTTTTTGAAGGGCGAGGTTGGCTTTTATTCAGCTTCTTCGATAAGAAAAGGGCTGGTAGTTCTCCAGAAAGCTACCTCGAAGCATTTGAACCGGGTCCTGGGCCGTCG
AGCTTACTTCGTCTCAGCCTACTGACCGCCCTCGATCTCTATGTCCGTCAGTTCGGAGGCCAGGCTCCAGGCAGCAGCGACGAAGAACGGGATTACGCATACTACAAGTTCGGCTTTGAG
GTGAGCATCTATTCGCTTCCAGCACCTTCTCTAACATCTTGTAACACGAGTGCTGTGACGCAAGGACTGAACTGCTCAGGTCCTGGATAGCAAACAACATCAATCGAATATTTGGAACAC
CGCTGAAAATATTTGCGGATACTTCTGCTCATTCTGCTCGAACTCCGCCTGACCCCGTATCCTTTCTTCCGCTCATGACAGTTCCCCGTCTTCGACAAGGTGAGCCTGGTTGCCGAAGTT
GTTGATGCTGCTCATCCACGGCCTCGGTATGGCCCATACGGGTGGGTCTTGCACGAGCGCGCCGCATGTTCGCTGCGATTTCAGCGCCCTCGTGGTGCGAAGGCAACCATGCTGCCCGTA
GATTGTTAGGATGTGCTGAGGTTGTCGCTCTGCCATATGCGCTCGATTTCGGATGGTAGCTGCTGGAGGGGCGATCATGCGTCCGCTGTCGCCTCTGGGGCAGATCGACGTAAAGGGTCC
TGCGATGTCACCTGTGTACGACTTCCTCAAGTCGAAGCAGCCGGGCGAGATTGAATGGAACTACGTCAAG
GTGGGTGCTATTGTGGACGTTGGTCGCAGATAAGATGTACCGAGTGCCTG
TCTCATGTGAGGCATAATACCCACAAGTTGACGCCTTGCTTGCTGGTGTAAGGAAAGGACAGCCGGCCGTTCGGGTTCGTCGGGCTGAAATTGTAGGAAGCGAAGGAGCAAGGCCATAAG
AAGCGTCTGGGCTTTTCCCTTATTGGATATGACTACAAGGCCTTTTCTTATGCTCGTTCAGTTGTGCTCTTTCTGACTCGCACCACATGACAAGTTTACAGTTCCGCGACTCTTGTTCGA
GCTGTCGCAACCTTCGGAAGCGAAGCCTTGGGCCCTTTTTGAGGTTGGTCGCACGGACATGGATCGATGCAAAAGTTGCCTTTGCGAGCGAGGACATTGAGAACTAAATCACGATCAGAG
GTGATCTACTTCGTCCCGCTAGGTTGGAAGAGAAGCGTATAAAGTCCGACCGCAAACGAATCTGCGAACCAGTTCTCGTTTCATCGTCGTTTTACCCTGGCACGTCAAGCGAACGGAGTG
TACTTTTCTGGTGCAGTTCTTGGTGGACCGCAACGGCGTCCCGGTGCGGCGGTACAAGCCCGGCTTCGATCCCGTGGTGAGGCCCAGCCCGGAGCATGGTATCGGCACGCAGATCCGTCC
CGTGACCCTGCACTTGCTGTCCGCCCAAGCTTCCCGTCTGTCTTCACTTGACGCACATGGGAATCGTTCAGTTGTGCTGTGCCGGATCAGAGGCGGATACCATCACGATATGGATCTGCA
CGATGATGCCAAGCCGCTTGTCTTGAAGTAACACCGCCGCCAAATTCTCTCCTGTTCAGAATTTCGAAGAAGATCTGGTGGCGACGCTGGCGGGAAGGTGAGCGACAGACCAGTTAGCGC
TTTAGCGGATCAGGCGCGAAATGCCAACTTCAAGAGGATCAAAAGGGTTGCCAGCTGCGGCCACGTCAGCCAAATCCTTTTTGCATTGCAAGTTCCCGCACTGTTTACCGCAAAGAGGTG
TAGTAATTCTGTACCAGCATGCACGTCTCAAGCCATTTCGAAGAGGTCCTTTCTGTCGTCGGCCTGAGAGGAGGTCACGTTGTCGCAGGCCCCTCCCTCCAAAGCAGCGAGTGTACCTTG
GCGCGCCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGGCCGCCACCTGTGCGAGGCTGCAGCCAGCTATTCTGCGCGGCTTTGAAAGTACAAAGCTCTCTCCTGTGAATGGTGGCCCCGGCCAGCGGCAGGCACTCGCTGTGCCCCGCAGGT
CAAGGAACTCGTGGTCCAGACTGCATTCCAGATGCATCCGTGCAGCCAAGGCTGTTGTAGAACCTGGGCCAACGGCTGACTGCAGTGACCAACAAAGATGGACTTCCAACCGCTTCGGCC
CCTCACGCAGGGAGCTTCTGGTCGCCACCACGGGAGGGCTGATTGGACTTCAAACAAATG
TTGCTGAAGCCCAACCAAAGTCGCTGTATGGATTCACCGTCAAGTACAAGGAGGAGGACC
TTTCGTTGGGGAAATACAAGAACATGGTACGAAGAACAACGAGCTTTTCAGAGATTC
GTTTCGGTCGTTCTCAACATAGCATCTGCGTGACCCCTGCAAAACGTGAACTATCCGGGTCTT
CGCTACTTGTTCAACAAGTACAAAGATCAG
GGGTTCGCGCTTCTTGCTTTCCCATGCAATCAGTTCGGAGGCCAGGCTCCAGGCAGCAGCGACGAAGAACGGGATTACGCATACTACAAT
TCCCCGTCTTCGACAAG
ATCGACGTAAAGGGTCCTGCGATGTCACCTGTGTACGACTTCCTCAAGTCGAAGCAGCCGGGCGAGATTGAATGGAACTACGTCAAGTTCTTGGTGGACCGCA
ACGGCGTCCCGGTGCGGCGGTACAAGCCCGGCTTCGATCCCGTG
AATTTCGAAGAAGATCTGGTGGCGACGCTGGCGGGAAGGCCCCTCCCTCCAAAGCAGCGAGTGTACCTTGGCGCGC
CATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTACAATGTA CTGTACATTC CTCCTGCATT GCACGAGTTT GCACCATTTT GGAAGTTGGG CCAGCATTCT GGCAGTGGCA GCCATGGTGG CCGCCACCTG TGCGAGGCTG CAGCCAGCTA  TTCTGCGCGG CTTTGAAAGT ACAAAGCTCT CTCCTGTGAA TGGTGGCCCC GGCCAGCGGC AGGCACTCGC TGTGCCCCGC AGGTCAAGGA ACTCGTGGTC CAGACTGCAT TCCAGATGCA  TCCGTGCAGC CAAGGCTGTT GTAGAACCTG GGCCAACGGC TGACTGCAGT GACCAACAAA GATGGACTTC CAACCGCTTC GGCCCCTCAC GCAGGGAGCT TCTGGTCGCC ACCACGGGAG  GGCTGATTGG ACTTCAAACA AATGTTGCTG AAGCCCAACC AAAGTCGCTG TATGGATTCA CCGTCAAGTA CAAGGAGGAG GACCTTTCGT TGGGGAAATA CAAGAACATG GTACGAAGAA  CAACGAGCTT TTCAGAGATT CGTTTCGGTC GTTCTCAACA TAGCATCTGC GTGACCCCTG CAAAACGTGA ACTATCCGGG TCTTCGCTAC TTGTTCAACA AGTACAAAGA TCAGGGGTTC  GCGCTTCTTG CTTTCCCATG CAATCAGTTC GGAGGCCAGG CTCCAGGCAG CAGCGACGAA GAACGGGATT ACGCATACTA CAATTCCCCG TCTTCGACAA GATCGACGTA AAGGGTCCTG  CGATGTCACC TGTGTACGAC TTCCTCAAGT CGAAGCAGCC GGGCGAGATT GAATGGAACT ACGTCAAGTT CTTGGTGGAC CGCAACGGCG TCCCGGTGCG GCGGTACAAG CCCGGCTTCG  ATCCCGTGAA TTTCGAAGAA GATCTGGTGG CGACGCTGGC GGGAAGGCCC CTCCCTCCAA AGCAGCGAGT GTACCTTGGC GCGCCATAAG CCGGTACATG GACGCATGTT GAAGCATCGG  TCGGCCTTCT GTGCTATCTC CAAAGGCTCT GTTCAGTCTG CATTCCCATG ACGGCGGCAC TCAGCAACCC GGCAGGGAGG AGTACCACTC GACAAAGATG AGACAGGCCA AGCACTGCCT  TAGTTGCGGA CGACGCATAG CATTTGGAGA GAAGCAGAGG TTGGTCGTCT GTTTGGGTGC GACACAACAG CGTGCATTTG CGTTGGCCTG CGTTTCATAT TACATCATCA ATTGATTGCA  TTTTGTTCCA AGAACATGCT CCAATTTTCG ATTGGCAGCA AGACTGAGAG CCCTAATTGT TTAGTGGGGC AGCAGTGTGA CTCAGTTTTT GGTTGTAACG CGATTGAATA TCCATACTGA  CAACTTTGGG AGCGGATCGC ATATGCTGAA CATTCTAGGG ACCCCGCTGC CTACCTTAGT TCCGTCAAAA TCTGCATTGA CAGTGACATG TGTGAATCTG GAGAGTCGCA GCTTAAAATT 
GTCAGGAAGC GACGG 

Retrieve as FASTA