Entry information : KflCCS01 (kfl00631_0040)
Entry ID 13858
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflCCS01 (kfl00631_0040)
Name (synonym) KflCCS01 (kfl00631_0040)
Class Copper chaperone for SOD    [Orthogroup: CCS001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflCCS01
start..stop
S start..stop
MpCCS01 254 2.79e-84 13..247 114..357
MpalCCS01 250 1.77e-82 12..247 100..349
ThasCCS01 239 1.41e-78 26..250 85..314
AtCCS01 233 1.44e-76 26..247 83..310
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13858' 'join(14100..14162,14523..14552,15257..15329,15918..16052,17792..17994,18401..18658)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14100..14162 61 N° 2 14523..14552 28 N° 3 15257..15329 71 N° 4 15918..16052 133
N° 5 17792..17994 201 N° 6 18401..18658 256  
join(14100..14162,14523..14552,15257..15329,15918..16052,17792..17994,18401..186 58)


exon

Literature and cross-references KflCCS01 (kfl00631_0040)
Protein sequence: KflCCS01 (kfl00631_0040)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   253 (290)
PWM (Da):   %s   26607.48 (30944.1)  
PI (pH):   %s   4.69 (5.66) Peptide Signal:   %s   cut: 23 range:23-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSGVRAGIPSRMVRAEAATAEASAEAAPELVTEFMVDMMCEGCATSVRNKLHPLPGVTDIRTSVSDQTVRITGTESLKSLQKALEETGRANRLIGQGSLEEFEISAAVAEFKGPVVMGVLRIAQVTKDTARVEGQFDGLKPGPH
AVFLNQYGDLTRGAASTGGIYID
GREAGFLGIANADETGHAELPTAVVQLRVYDLIGRALVISESDKVSTENAFASVVARSAGVGQNLKNLCSCDGTVIWEAQQDRVS*

Retrieve as FASTA  
Remarks Copper/zinc superoxide dismutase
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGGGGTCAGAGCAGGAATCCCATCTCGGATGGTCCGGGCTGAGGCGGCAACTGCGGAGAGGTAAGCCAAGCAGCGGTTTCGCCCTTGTCGCTGTTTAGATTGTTCGGAACACCAC
GAAATTACATAGTCTATCAGAAGATTTTTGTGATAGGGGGCAGAGTGTCCAGACAAGACATTGTATCTTGGAAGATGAACTTAAGTGCAGAAGCGCCACATCGATTGGCTAAGGAGTTGC
GGCTATTGCTCTGGATAGCTTGACTGATCACCTGCATGGGTTGACCTTCTGCAGAATCTGGAGGGGAACTTGGCGACACTTTTAGATCGTCCGTAGGACAGTAGTGTATAAGCCGTTGTT
TGCAATCTGTACTGCACCCCTGCTTAGGACTATCTCTTAAAGATTGAACCTTGTGTACTGTGCAGGCAAGCGCTGAAGCTGCACCGGAGTTAGTGTGGTAAGCGGCAAACTATGTTTCAT
GGAAGCTGACTTTCAATTTTTGCTGATTGCTTGGTTGATTTCGTTGGTCTGGTGTTTTGATCGAACAAGGGTCTTGTGCAAAAATACCCCCGCGTCAGAACACGCTTGCAGTGGACATGC
CCATTGAAGGTCGCCCCGTGAACTTCTGCAATGAGAATGATTTTCAGGATGTGCATCTCAGTTGCCCAGTCTGCACCCCGCGCTTCTGTGTAACACTGGCTTGGATGGTATTGTAAGAAC
GTGAGACATTTTCATCTGTACATGAAGATAGTCTCAGTGAACCGACTGTCAACCGGTAGAGACTTCTAATGTGCTTCTGGGACAGGTCCCTCTACCTTCAGAAGAATAGTAGGCCATAAA
GTTTACAAAGAAATAAATTGAGTCAATTAATTCACATGTTTTGAGAAGTGTGGGTCTTAGTGGGGCTAGCGTGACATACAAGTTTCGCTTTCATGTTATCTTAAGGGCTATGTTGAGTCT
CCGCAGTTCCTTTCTGTTTTGCACAAAGTAAAACCTAGATGAGATCGACATGCTCTGCAAGCGTGCCCGCTCTAAGCCCCCAAACCAAAACCACTGATCGCTTAGGCAGTGACCTGATTC
AAGATAGCCGTAACTAATCAAATTCGAATTCACTGCGTGATATATGAGACCGTGAGTTTTGGTGGGGCCTTGTGTGTACAGACTGAATTCATGGTGGACATGATGTGCGAGGGGTGCGCC
ACCTCGGTCCGCAACAAGCTGCACCCACTGCCAG
AGGTAATCCCACGCAGCCCTGCATTTTGTGTGAAGGCCAGTTTACATCACTTTTAGCTTGCGAATCCACTTTCTGATTGAAGATGA
ATTGTAGGCAGAGGAGGCTTACATCTATGTCTCTCTCAAAAATGGAATCTGCTTCGTGCGCTGGAACTGAAGGATGAGAGGAACTGTGTCTAGTAAAGTTTCCTGGGACTGTCTTTGTAG
TCACTAAAAGTTTGGAGAATGGAACAAGCTGCTTCGGCGAGTCACGGAAAACAGCATGTCTTAGTGGGGGGAAGCAAAAGATTTCGAAGATTGGATTTCGGCTGGTCAGGATCACAAATA
TAGTTAGTTTGCGTGATGAAATCAAGCGTCTCAAGGCCAAGCGGTAGCGTAAGTAGATCTAACAAAAGGCTGTCTTTACAGAGAAGACGCTTCGTAAGAATAATGAGAAGCTTGGAAGTA
AATTTGCTCAAAGAAGTTGATTGCTTCGGAAGGGCAACGATGAATCGAATCCTTTTTCCCCTGTAGGTTTGGCAACCTGATCGTGGTGTTCTATCGGGCAGCGAACTTGCATTATTTTTG
ACATGGTCTGCCGTCGATTGGCAGGTGTGACTGACATCAGAACGAGCGTGTCGGATCAGACCGTTCGGATCACAGGGACAGAGTCTCTCAAGTCGCTCCAGAAAGCTTTGGAAGAGACGG
GAAGGGCGAACAGGCTCATTGGCCAAGGATCGCTTGAAG
AGGTAAGATTTGAGCAGTTCAAAGAATCAACGGCTAAGTCTAGATTAGGGGTTTTCAATGAGCTGTTGCGATCTTCACGAC
TCATAGCTCCTAACCCTTTTGTCATACAAAGTTTGAGTAGAAGCTTGTCAAATGCAAGCATCTAGTGCCATCTACTACTCTCTCGCTTGATGTGGCTTCATGTGCTTCAGGACGATCCGA
CATGTGGTTTGACCCGTCACGTTTTTTCCACATGAGTTGCAATGTGATATTCCTTTTTGAGTTCCTCGTTCTCGAGTGATGCTAGCGACTAAGTCCAGGAATCTGCGAATTTCCTTTGAA
CGTTTCGAGGCCGAGCCGAGATCATCAGGGCTCTCACCGTCTCTCGCTCATTAAGTGGATGCTTAATTTGAGACCGTCGAATCTATTTGCTTTGAGATCGATCAGAGTCCGAGGGTTTAT
CCCCCGAACCTCTCTTTCCGGTTGAAATCTTGAGGTTGAAATTCGTCCTTTTCGTTATTCGTCCTTTTCGTTTACGTCAGGATTTCGGAGGGTTGAGATCCTCTTCTCCTCACTCAGAGT
TGTTGAAAAGCCTCCAAAATCATCAAAGACTTGTTTTTTCGAGAGGATTTTGTTGACCACGTCCCTCTAAAGCTCGTTGAGCAGACTGTTCAATCTGGCAGCGGAGGACCTCACACTCTC
ACGTCGCAAGCTGCTCTCTCGGGTTTATGAAAGACTTTTCGCACCGTCCGGAAACTCTTTGGAACCTCGAGAAGGGTGTTTCGAAGTGGACCGCTCGCAATCAGCTTTCCAAAAAGTTGT
TTCGCAGAGTGCAAGACTTTGGGGCTGTGGCGGAGCCAAGGGCGCTCACCGTCTCTGCTCAATGAATGTCAAAGGGGCCTAGACACCGAGCACAAGACTGTCAATTTGATGCTCATTCAA
AAGGACTTTTTGCGTTCTGATTGTGTTCTGCAGACCCTGCACTGCGGCGTTGATGGGCAGACTCAGCGTCCCTTACTGCTCCTGCTCACAGGTCTGCAGGGAAGATTTGCAGAGCAGTCA
GTATGTCGAGTCCAACCTTTCTGGGACCGGTTCGCAACCCTCTGAGTCTCGATTTGCGAAGTTCAATCGATCGTGGCGGCAGAGTAGGAATCAGCCGACTTCCTCGCGGCTGCTCACGGA
CTTGCCTGGTGTCAGCAAAGCCGCACTTACGTCCGGAGAACGATTCTGGAAGCTCTCGTAGTCGCCCAGATTCCGTCGCGAATTCCGTTCTGATCCCGTTTCCGCAAAGTTTGAGATTTC
CGCAGCAGTGGCGGAATCCAAGGGCCCGGTCGTAATGGGCGTCCTCCACATTGCGCAAGTCACCGAGGACACTGCCCGCGTGGAAGGGCAGTTTGACCGGAATCCTGCTGACTTTGTTCT
GATTCCGTTTCGGCAGAGTTTCAGATTTCCGCGGCGGTGGCGGAATCCAAGGGCCCGGTCGTGAGGGGCGTCCTCCGGATCGCGCACGTCACCAAGGACACTGCGCCGGTGGAAGAGCAG
TTCGACCGGATTCCGGCTGAATTTTGCTTTCTTTAAAGTTCCGATTCCGTTTCCGCAGAGTTTGAGATTTCCGCGGCAGTAGCGGAATCCAAGGGCCCGGTTGTGATGGGCGTCCTCCGC
ATTGCGCAAGTCACCAGGACACGGCCCCGGTGGAAGGGCAGTTCGACCGGACTGCGGCTGACTTTTATCTCTTTAAATTTTCTGAATCCGTTTTCCGCAGAGTTTGAGATTTCTGCGGCG
GTGGCGGAATTCAAGGGCCCCGTCGTAATGGGCGTCCTTCGCATCGCGCAAGTCACCAAGGACACTGCCCGGGTAGAGGGCCAGTTCGACGGACTTAAACCGGGCCCGCACGCCGTCTTC
CTGAACCAGTACGGGGACCTGACCCGGGGGGCGGCCAGCACCGGGGGTATTTACATCGACGAG
AGGTGGGTGCAAGTCCTCGGGTTGGTGTTTAGCCCCTTCGAAGTTGTCTATGGCTTT
CGGTCTGTGTGTTGCTTTAAAAAGGGTTCGACCTTGTGTTGGTTTCATTGGGGGTGAGAACGCCCTGGTGAACAAAGACGGCTCCTTTCATAGCCCGACGCCGGTCGATTCTTGAGTACC
CTTTTGAAGTGCGTGTTGGTTTCATTGGGGGTGAGAAGCTTCTCTTGTGAACAAAGACAGCTCCTTTCATAGGCCGACGCCAGTGCAGTTCTTAAATGCGCCTTGAAGTGTGTTTGTGCT
TGGCCAAGCCAACGATGCCTCACAGGAAATACGCAAGATAGATTATCAAGCCCTGTACCTCGATCCCAAAGGCTCCAGACCTGGTCAGACAAAACCCACTTTTTGTTGCAGGGGCGGGAA
GCGGGGTTCCTGGGAATTGCCAATGCTGACGAAACCGGCCATGCGGAGCTTCCAACGGCGGTGGTCCAACTACGAGTGTACGATCTGATTGGGAGGGCTCTGGTGATCTCAGAAAGTGAT
AAGGTTTCCACGGAAAATGCCTTCGCTTCGGTGGTCGCAAGGAGTGCAGGCGTGGGGCAGAATCTGAAGAATCTGTGCTCGTGCGATGGCACTGTAATCTGGGAGGCCCAGCAGGACAGG
GTATCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTGGGGTCAGAGCAGGAATCCCATCTCGGATGGTCCGGGCTGAGGCGGCAACTGCGGAGGCAAGCGCTGAAGCTGCACCGGAGTTAGTGACTGAATTCATGGTGGACATGATGTGC
GAGGGGTGCGCCACCTCGGTCCGCAACAAGCTGCACCCACTGCCAG
GTGTGACTGACATCAGAACGAGCGTGTCGGATCAGACCGTTCGGATCACAGGGACAGAGTCTCTCAAGTCGCTC
CAGAAAGCTTTGGAAGAGACGGGAAGGGCGAACAGGCTCATTGGCCAAGGATCGCTTGAAG
AGTTTGAGATTTCTGCGGCGGTGGCGGAATTCAAGGGCCCCGTCGTAATGGGCGTCCTT
CGCATCGCGCAAGTCACCAAGGACACTGCCCGGGTAGAGGGCCAGTTCGACGGACTTAAACCGGGCCCGCACGCCGTCTTCCTGAACCAGTACGGGGACCTGACCCGGGGGGCGGCCAGC
ACCGGGGGTATTTACATCGACGAG
GGGCGGGAAGCGGGGTTCCTGGGAATTGCCAATGCTGACGAAACCGGCCATGCGGAGCTTCCAACGGCGGTGGTCCAACTACGAGTGTACGATCTG
ATTGGGAGGGCTCTGGTGATCTCAGAAAGTGATAAGGTTTCCACGGAAAATGCCTTCGCTTCGGTGGTCGCAAGGAGTGCAGGCGTGGGGCAGAATCTGAAGAATCTGTGCTCGTGCGAT
GGCACTGTAATCTGGGAGGCCCAGCAGGACAGGGTATCGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CAGCCTCAGA GAAGAGACGT TTTCAGCATT GCGGATTCTG CACGTCCCTT CTCTTCCACT GCCAGATTGC CTTTCCTCGC CCTTTGAACG CCCTCAACCA GCTTTGCATC TGTCTTCCGT  TGGTCACCGT CGTTGCGTAA ATTGCTGTCA CCTGCGAAAG CAAGCTCTCT GACCTGCCCA CTCGTGTGAT GGCCTCCGCA CTGCGCTGTT CCACAACTCT TGCAGCAGCC ACCATCGCTG  CAGCATCGGT TCAGACAACA AATACGCATC AAGCTAGAAA TCAGTCTCTA GCCGTCTCTT CTGGTCCGTC CAATCCCTCA GCAGCTGGCC CATTGCTCGG GGGGCTGTCC AAAGACTTTA  CTGAGAGCCA CAGAGGAGCA GCAGGCGCGT CCACATCAGA CAGGTTTATT TCAGTCATGA GTGGGGTCAG AGCAGGAATC CCATCTCGGA TGGTCCGGGC TGAGGCGGCA ACTGCGGAGG  CAAGCGCTGA AGCTGCACCG GAGTTAGTGA CTGAATTCAT GGTGGACATG ATGTGCGAGG GGTGCGCCAC CTCGGTCCGC AACAAGCTGC ACCCACTGCC AGGTGTGACT GACATCAGAA  CGAGCGTGTC GGATCAGACC GTTCGGATCA CAGGGACAGA GTCTCTCAAG TCGCTCCAGA AAGCTTTGGA AGAGACGGGA AGGGCGAACA GGCTCATTGG CCAAGGATCG CTTGAAGAGT  TTGAGATTTC TGCGGCGGTG GCGGAATTCA AGGGCCCCGT CGTAATGGGC GTCCTTCGCA TCGCGCAAGT CACCAAGGAC ACTGCCCGGG TAGAGGGCCA GTTCGACGGA CTTAAACCGG  GCCCGCACGC CGTCTTCCTG AACCAGTACG GGGACCTGAC CCGGGGGGCG GCCAGCACCG GGGGTATTTA CATCGACGAG GGGCGGGAAG CGGGGTTCCT GGGAATTGCC AATGCTGACG  AAACCGGCCA TGCGGAGCTT CCAACGGCGG TGGTCCAACT ACGAGTGTAC GATCTGATTG GGAGGGCTCT GGTGATCTCA GAAAGTGATA AGGTTTCCAC GGAAAATGCC TTCGCTTCGG  TGGTCGCAAG GAGTGCAGGC GTGGGGCAGA ATCTGAAGAA TCTGTGCTCG TGCGATGGCA CTGTAATCTG GGAGGCCCAG CAGGACAGGG TATCGTAGTT GTGGATTAGT GGGAGATTGG  TCATCTAGCA TCTTGTCGTA TAACTTGTTG AAGCCTTTGG CGGACTCGAG CACCCGATGA ACGTTTTTGG ACTCGAGTGG GAGAAACGGA ATCTGATCAA CGAGCCTTCG TGCGGTACAC 
ACTGGTTATA CCAAAGACGT CCAAACGATT CTTTGGACAA TCTCGTTAGG CGCGCGCTCA TTCAGGATGA CTGCATGCTC CCGATTG 

Retrieve as FASTA