Entry information : KflCSD02 (kfl00631_0030)
Entry ID 13859
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflCSD02 (kfl00631_0030)
Name (synonym) KflCSD02 (kfl00631_0030)
Class Cu/Zn SOD    [Orthogroup: CSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflCSD02
start..stop
S start..stop
PpaCSD04 271 1.4e-93 11..209 1..203
PpaCSD03 270 5.32e-93 6..209 1..205
NoffCSD02-1B 256 9.18e-88 15..209 8..206
AtCSD02 251 7.92e-86 25..209 24..215
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13859' 'complement(join(9325..9353,10072..10125,10610..10717,11516..11611,12020..12121,13047..13293))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13047..13293 245 N° 2 12020..12121 100 N° 3 11516..11611 94 N° 4 10610..10717 106
N° 5 10072..10125 52 N° 6 9325..9353 27  
complement(join(9325..9353,10072..10125,10610..10717,11516..11611,12020..12121,1 3047..13293))


exon

Literature and cross-references KflCSD02 (kfl00631_0030)
Protein sequence: KflCSD02 (kfl00631_0030)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   211
PWM (Da):   %s   21397.92  
PI (pH):   %s   7.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASACIASSALASASLSSSFKSVLPSTQVQSSFLGHAICAKPAHKVSYRRELVISAALKKAVAVLKGESKVTGTITLEQEDDGPVKVTGKITGLAPGEHGFHLHQFGDTTNGCISTGPHF
NPNGKTHGAPGDEERHAGDLGNVVADDQ
GVATINITDKQIPLSGPNSVVGRAFVIHELKDDLGKGGHELSSTTGNAGGRLACGVVGLTPTS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCTTGCATCGCCTCCTCCGCCCTGGCCAGCGCCTCCCTGAGCAGTTCATTCAAGTCCGTGCTGCCCTCCACCCAGGTGCAAAGCTCCTTCCTAGGGCATGCCATCTGCGCC
AAGCCCGCTCACAAGGTTTCCTACAGGAGGGAATTGGTCATCAGCGCAGCATTGAAGAAGGCCGTTGCAGTGCTGAAGGGAGAGAGCAAGGTCACTGGGACCATCACGCTGGAGCAGGAG
GATGACG
GTGAGTGAATAGACGCTGGCGCTTCTGGTAATGCTGGAATGCGGGAGTGGAATGTGGCATAACAGATTGCCTGCATGCATCCATACCACCCTTCCTTGCTGCATTTTCAACAA
AATTTCTCTGTATATGATGATCAATGTTGTCAGTTTGGATACAGTGAGTGAGAATAGTTTTTGGATAAGCTGCAGTATTGCGCTGCCGACTGCTTCTGGATAGTCTCATCCTGGGAACGG
ATCATTTTGATCAAGCAGACTAGTGCTGGACGCTTTCTCCTGTTGAGTCGATCGATGTGCAATCTGGTCTTCCAGAAATATATCTTGCTGCTGAGCAGGTCGATGTCTTGCTGAGCAGGT
GGATGTGAAACAGCTTGCCTTTGATGGCGCTTTAGAATTTTGTCCCCAAAGGTTTTTGTTGTTTCCATGGACTAGAATTTCTGGCAGCATTCCCTTTTGTCCTCGAACCAAGCTGTTGGG
CCATATGAAACAGCGGTATGGCGAATTGTGTCACTGATGTGACCCAGTACGGGGAGGTGGAGGGGAGGGGGAGGGGAAGGGGAGGGGAGAAGTTGGAGCGGATGAGAATCTGGCCAATCC
ATCTTGATCAGGAAGGTCATGCAGCCTCAGCATTATGCAGAGATTATTCACACATGTATCAACGCCGATCCCATTGTTGTTGGAAAACGGTGCTTGCTGCATTGTTTGTCTTTTGAATAA
GGAAGTGGCCAGAAAGAGCAGCGCGCACGCTGTAGACACAAAGAAGAAGGGAAACCCTTGAAAGTATTACTGTTTAATGCTGGTGTCAAATCTCCAAGGCTCGTCAACCGCAGTAGACAT
AAACATCCGCATACTGGAAGCACTGAAAACACTGCCGTCATGTAGGTTGATCAGGGGGTTTTTCAAAGGGGATTTTTTTGAAACATCTGCAGGCGCCCGGTGAAGGTGACGGGGAAGATC
ACTGGCCTGGCCCCTGGCGAGCACGGCTTCCACCTTCACCAGTTTGGCGACACCACCAACGGGTGCATTTCGACTG
GTGAGTGTCTGCTCCAGTGCAACAACAATGCTTGGCTGGATTGA
TCTGAACCGTGTACTCGTTCGCACAAGAAGCACATGCTTCGTACACCGATCGTTCAGCGAAGCTCAATCTGTTGACAATCAAATTTTGCTCATTCTCAATCATCATTCGGTGGTGCATAC
TGCCTTTCAACCTTGTATAAGTTGACTTGTTGGTGTAGTCAGCACGAGATTAGTGAAGCATGGATCAGAAGGTCGCCCTCCGTTTCTTCTTCGCCACCAGAACGAGACTGTGCTTCTTGC
AGGGCCGATGCTCCAGGGCCCCTGAGCAGCGAATCAACAACTAGGAGCTTCTTAGTAGAAAGCACATCTGGCCACTTACCTTGTCAGTGTATGTTCAGATGACAAGCATTTATTTTCTTT
GCAGGTGTCCTCACTTCAACCCCAACGGCAAGACCCACGGGGCCCCTGGCGATGAGGAGAGGCACGCGGGGGATCTTGGCAATGTTGTTGCTGATGATCAAGGTAGTGATTTACCATATC
TTCTTCCAACAACTGCAATGGACATTTACAGATTACAGACGGGGCCATTTATTGCTTGGCTTGGTCTGTAAGCTCTTTTTCCTTCTGAGTTTCAGGACTGCTGCCTAGACTGCAATTTTG
CTTGAAAGCCTTTCTGTATTTTGTACTATCTTAACATCTCGCTTCTTTCTGTGCAAATGAGTACTTCCAGTGTGTCTGTGAGTAAGGTGTGTCTCTTTCTAAAACCATCCTCGCAATCAA
CCTTGAATCAACACCTGGATACACAGTGGGCTAATATTCTGGGACACTTGGCAGACTTGCTGCACGGGAGCGCTGCAACGGAACGCTGGTTTTTCGTTCTGGTTATCAAGATCTGACAAG
CAAATAAAAAGCGGTTCTGTTCTGCAAACATGTACAATTGTTTGTCTGGAATGAGCAACCCATGCACTTTCGCCTTTGCCTGATTGATAAGGCACGTGCACCTCCGGATACCTGTACTCC
GTCTATGGTCTATTTTGTTTGTTGTATGATCCTGTTCTGCTGTTAAGTCAGACCAAGCAGTCCATTACTCCATTGTCGGGCTCTATGAAGGCCCCAAAAAATCCACCTTGCTTTGCCACG
GTCATCGAGTGAAAGTTACAACCTTTTGGTGGCAGTTGATCATGGCAATTTTTTAACCTGCAGCGCACACGCCTATACGCACTTCGTTTGCCCCACAGAGTATAGTTTGACAGGTGTGCA
CGCCTTGCTGACCTAATGTCACCAAAACACTGATGTCACCCACTGCTGTCGCTCCATCAGGCGCGTGGCTACCATTAATATCACCGACAAGCAGATTCCCCTCAGCGGGCCCAACTCCGT
CGTTGGTCGCGCCTTTGTTATTCACGAGCTCAAGGACGACCTCGGCAAGG
GTAAGCCACATTCCGTCTGCTTTACATAGTATCCTTGTTTGCGTCTGTCTCTTTTCCACTTTCTCAGGGC
TGTGCGTACCCGAGTGAGTGCACACGATCCTGCTGAGATTCTATAGCACCGTATCCTCTTAAAGAGCGTTCACCCTCTCTGTTACCATTTTTCTTCGTGAGAAAGAAGCAGCGTTAGTTC
TTGTTCAGGAATCTCGCAGCCCGGAACGGGCCCATCACTCTGACGCCTTTCAACGGCGTCTTCCAAAGCAAAGCCGAGCAACGTTGCACGACGTTGAAGCAAAAACAAAAACGAAAACAA
ACGAACGCAACAAGTCACTTTGAAGTATCCAGTAATGGGACCACACTGGAGCTTGTCGTTTCCTCTTGATATGGCTGCCACAGATTCTGTCTCCGGTGTCGAGTAGCTGCTTGTGTCAAG
TCTCGGTCCTCCTTGAGATGTAAAATGATATTCGAATTTTTCGTTTCTTTTCAGGCGCGGCCACGAGCTGAGCTCCACCACAGGCAACGCCGGAGGCAGGCTCGCATGCGGTGAGCATCT
CGCATTATTTCTCTTGTCACTTAAGAGGGGCGGAGCTTCATTCTGCCTTTCTGAACCTGTCAGAAAGTCTTAATTAACAAATACGAGATGCCCCCTGAGTGCATGACAAGGGGGGCGGTA
AAGCACCTCACGTGCTCACCAGCGAAAGCTTAGCAAGTTTCAGGCGATGCCAAAGTGCTACTACTGACCAGCGGATCTCTTTGTGCGCGCCTGGCAAGCTGTCTCAGTTGCTGTCGAGCG
ATTGTCGGAGATGGCTGCCATTCATCAGCATCGCAGAATTATACCTTCCTGCGCCTGAAGCACTCTCCTACAATGAACTTGTATCTTTACGCTGCCGGACTAGTCTTTACAATGTCGCGA
AATCACTGCCGTTACTTTTTTTGGTTGTTGGAAGTGGCTCTGCAGCTATTGGAGGGTGTTGATATTGTGTGCCTGCTTCTATTCACTCGTTTGGTCGCAGTTCAATAGGTGAATGGTTGC
AACCCTCTTGAGAGTCAGGACTGTCTTGTCGTGCCTACTGCATGCCGGTTTTGGACCTGCCTCTTCGAGTCGTTTCCAATCCTCGTTGAAGTATTTTGCTGAATCCCGTCGATTTGCAAG
CTATGCTCACGTTTGTTGCAAAGCGAATTGTGAAGAAAACAAAAAGTTCCGATAAAGTCATTTACAAACGAGAGGTTTGATAGATTGTTGTACTTGAAATTGTTGCAGGTGTGTTGTTGG
CCTCACCCCTACATCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGCTTGCATCGCCTCCTCCGCCCTGGCCAGCGCCTCCCTGAGCAGTTCATTCAAGTCCGTGCTGCCCTCCACCCAGGTGCAAAGCTCCTTCCTAGGGCATGCCATCTGCGCC
AAGCCCGCTCACAAGGTTTCCTACAGGAGGGAATTGGTCATCAGCGCAGCATTGAAGAAGGCCGTTGCAGTGCTGAAGGGAGAGAGCAAGGTCACTGGGACCATCACGCTGGAGCAGGAG
GATGACG
GCCCGGTGAAGGTGACGGGGAAGATCACTGGCCTGGCCCCTGGCGAGCACGGCTTCCACCTTCACCAGTTTGGCGACACCACCAACGGGTGCATTTCGACTGGTCCTCACTTC
AACCCCAACGGCAAGACCCACGGGGCCCCTGGCGATGAGGAGAGGCACGCGGGGGATCTTGGCAATGTTGTTGCTGATGATCAAG
GCGTGGCTACCATTAATATCACCGACAAGCAGATT
CCCCTCAGCGGGCCCAACTCCGTCGTTGGTCGCGCCTTTGTTATTCACGAGCTCAAGGACGACCTCGGCAAGG
GCGGCCACGAGCTGAGCTCCACCACAGGCAACGCCGGAGGCAGGCTC
GCATGCG
GTGTTGTTGGCCTCACCCCTACATCCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCATGCACAC CACATTTTGG AGAGATTCAC ATTTCACTGA TCAACATATC AACAGCCTGC AATTCAACCT GCTTCGTGAA ATTCATAGAC TTTCTTACAT TCGCCTAACC ACCTTCCATA  AGCGCTGCTG CAGCCATGGC TTCCGCTTGC ATCGCCTCCT CCGCCCTGGC CAGCGCCTCC CTGAGCAGTT CATTCAAGTC CGTGCTGCCC TCCACCCAGG TGCAAAGCTC CTTCCTAGGG  CATGCCATCT GCGCCAAGCC CGCTCACAAG GTTTCCTACA GGAGGGAATT GGTCATCAGC GCAGCATTGA AGAAGGCCGT TGCAGTGCTG AAGGGAGAGA GCAAGGTCAC TGGGACCATC  ACGCTGGAGC AGGAGGATGA CGGCCCGGTG AAGGTGACGG GGAAGATCAC TGGCCTGGCC CCTGGCGAGC ACGGCTTCCA CCTTCACCAG TTTGGCGACA CCACCAACGG GTGCATTTCG  ACTGGTCCTC ACTTCAACCC CAACGGCAAG ACCCACGGGG CCCCTGGCGA TGAGGAGAGG CACGCGGGGG ATCTTGGCAA TGTTGTTGCT GATGATCAAG GCGTGGCTAC CATTAATATC  ACCGACAAGC AGATTCCCCT CAGCGGGCCC AACTCCGTCG TTGGTCGCGC CTTTGTTATT CACGAGCTCA AGGACGACCT CGGCAAGGGC GGCCACGAGC TGAGCTCCAC CACAGGCAAC  GCCGGAGGCA GGCTCGCATG CGGTGTTGTT GGCCTCACCC CTACATCCTG ATTTGTATGC GGCGGCGCAA TAATGGGTCG CCCGTGCCTT TCAATCTGGT AAATGGAGCC TTGATAACAA  GAAGGCATAG CAATTTTTGA CTTTTCGAGG AACCATAGAA AGTACTTTGC GACCCTTCCT GCAAGCACAA GCCGTTTCTT ACTGCACTTT CGACCAGTTT TCCACAAGCA AGATCATCAT  CCAAGGATGC ATCCCTGGCC GTTGGTGTGA AGTCTCCGAT TCGTCCTGTA GCACTTCAAG AGTCACAATA TACCCGTGGA ATGAAGCAAT TGTGTGTACG GGACCGGCAT GTGCTGACTT  GGTGAACTTC GCTGGTCAGG GACTAACATC TGCTGATTCA TGAAGGTCGC TGGTCAACCA AGTGTGTGCA TGCAAGGTCT GGAGCAGAAT CATAAATCAG AAATGTTAGA AACCTCAGAA  ACAACACCGG AAAAAAAAAA AACCCCGCGG AAAAAGCGGA TTTTAAAAAC TTGATTCGGC CGCACCTCTA ATCAGGAACA TTTCAAGAAG TTCAAACCTT TGAGGTTACC TTCCATCCAA  CGAGAGTCAA TTTGTTCGCC GAACCCGTCA AGTTTTACTC GGTTTGGAAA GGTTGAGGGT GTACGTCCGG TTAGTGAGTG GCCCCCTCAT TGTGTGTGGA CGGTCAAGCG GACTTTTTGA 
CTATTTTGGG GGGCGATGAT GTGAGACAAC TGTCAGATTG GCCGGGCCGG GCTGGTTTGT AAAGTGCAAA TCTGAAAGGG TG 

Retrieve as FASTA