Entry information : KflCSD03 (kfl00897_0010)
Entry ID 13860
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflCSD03 (kfl00897_0010)
Name (synonym) KflCSD03 (kfl00897_0010)
Class Cu/Zn SOD    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflCSD03
start..stop
S start..stop
CbraCSD01 189 7.82e-62 2..128 1..127
AtrCSD02 188 2.14e-61 2..128 25..151
LeCSD01 187 2.7e-61 2..128 1..127
NoffCSD01-1A 184 4.09e-60 4..128 3..127
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13860' 'join(411..489,1873..1974,3582..3709,4497..4572,5033..5193,5545..5598,6177..6227)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 411..489 77 N° 2 1873..1974 100 N° 3 3582..3709 126 N° 4 4497..4572 74
N° 5 5033..5193 159 N° 6 5545..5598 52 N° 7 6177..6227 49  
join(411..489,1873..1974,3582..3709,4497..4572,5033..5193,5545..5598,6177..6227)


exon

Literature and cross-references KflCSD03 (kfl00897_0010)
Protein sequence: KflCSD03 (kfl00897_0010)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   216
PWM (Da):   %s   22528.49  
PI (pH):   %s   7.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVLKAVAVLQGQSDVSGTVTFTQDGDGPTHVEGQIKGLKPGPHGFHIHQLGDTTNGCMSTGPHFNPTSKTHGAPGDEERHVGDLGNVIAGDDGVASLKLDDIQIPLTGPHSIIGRAVVVH
ADVDDLGKAQAVVRVRKKRWFEKSGEEEEGWGRLKGREGGEGTGKRPRKCGEEGGVCGDGLKVGTSSARPLAMREAVLHAASLDWLKLSLGGVKGA*

Retrieve as FASTA  
Remarks copper/zinc superoxide dismutase
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTCTTAAGGCGGTCGCCGTGCTGCAGGGTCAGAGCGATGTTTCAGGGACAGTCACCTTCACGCAGGATGGAGATGTGGTGAGCTCTGCTTTTGTTGCATCATTCGAGTTGTGGCGG
AGATGAACATGTGGACCTCATCGATGAGCTGAATGTTCCTTCATTGTGGTTGGTTCCGATTCTGGTGAGTTTATTGTTTCTTCTAAGTAGCCTGTTTGGCGAGTTGTAGTGGCCGCACAC
CTCAATCCTTTCAAATGTCTGCCTACTTGCATCAATTCTGCCTGAGCCGTTCCACTATTCACCCTATGACTTCCATTCCATAGATTGCAGTAATTGTTCTACAATGGTGCTTGTGTGGTT
TGTTGATGACAGCCTCTGAGAGTTGGAGATACGACGCATCAGTTTCACTGTTCTTCGCTTTGTAATGCTGTCACGTGAGGCAGTCAAGAATCGCATGCTTCTGCATGCTATATTTGCTTA
GGGCATCCACATATCTGTTTCGCCTTAGCGCCACCTGTATTGAAGCTTTTAAGGTTGCTAGTCCTCCCTTTCTGACATCAAAACGATTCCTAAGAATTTTCAGTGGCTTCGGTCATTTGT
ATCAGTGCAACCTGACGCATCAGCTGCTCCTCCGTTTGGAAAGTTGCTCAAATCTATGCTGAAGGAAATGCTGATGTTGGGGTTGTCTGGAGAAACGTGGTCACCGCATCTAACCAACTC
AAGCAGTGGCTCTCAGATTGGTGTGATCGTTCGCACGCGGCGCACATCTAATCACTGTCCACGCAGCAGTTGCAAGTGTCCTGAAACGTCTTCAGTAGTTGAATTGCGCAGAGGCTCAAA
ACCTCTGAAAAAGTTTACATTGCTCCTCATTCTTCAAGTGAACAGGTCCGACTGAAAGTGGAGGGTCATGCAAGGGCTTGGCATCCCTCGCTCCATTGGCAACTCGGTCTCAAGTGCCTG
CAACTAGATCATTAGAAACACTTGTCCCTTTCTCGAAAGAGAATGTCTGGCAGGTCTGCCATGGCTTCTGCTGTCAGACCTTTCGGCAAAGGAGTCTGGTCATCATCTATTTGCGCTTGC
AGGTCCTAATCACTTGGAGCGACAAGTATTCAGAAGGACTCCTTCTGTTGGCCCAAGTCAAACAAGTTCAAAGCTTTTAAAGCATTTTCGACACTCCCCTCAATGCTTTTTTATCGCGCC
AATGACATGAAGGGGCAGATTAAGGGCCTGCACCCGGGCCCCAGTGCCAAGCAGGAACTAGAAGTGTCAAAGCATCCAGGTCATTGTTGCTCTCATCTTTTTTTCACATCAGCGATCGCT
ATTGATCCGCAGGTCCCAAAGGGGAGAGGCAAATGAAGGCCAGAAGCGGTGTCATCAAAGTTAGTAAAGGACTGGGCAAGTGAAAAAGCCTTCAAGTCATCACACAAATATTACTGACAC
TAGCGAAACATTTTGGGTTTGCAGGTCCCACTCACGTGGAGGGGCAGATCAAGGGCCTGAAGCCGGGCCCCCACGGTTTTCACATCCATCAATTGGGGGACACCACCAATGGCTGCATGT
CGACCG
CGGTGAGCTTCCACTAGGGGACGGCATAAAGAAGTTGAGATCTACGTGAACTGAGGGAGCTGTTCTGCGGTCTTTGTGATCCTTGTACAGAAGGACAAGGCTCAACTGATTACG
TGGCAAGAAATGTTGAAAAGCATTGTTGGTCAATTGGGAATCATCCTTACCCTGACTGGAGGTGCGCAGCATGAACATCAAGTGGCTGTTTTATCGATGTCAAGCCTTTAGTTTAGTCTC
GGTTGGCAAGCAGTGGAATGAATGATGAAAGCTTTAGCAAGCTTAAAGAGGGATGATCTACTCACCAATGGCGGAGCCAGAATAACTGACCGGACTTGTGCCTGAATAATCCTCTCAACT
GGAATCAGCTTTAGGAACAAAACACCAGGGCCCCATTTCGATCTCACCAAGAGACTCACCGTTCTGCCTTTTAATCACGTCTTAAATTGACACTGGTAAAACACAACCCAAGAAACTCTC
CTTTTGGAAGGCCCCCTTACAATTCTTCCCACAGGGCTCGCTTTTCTGATAATCTATCACGGAGCCCCAGGCCGTTCTTTTCCACGCATCTGTAGCTGGAGGAAAGTCGATGCGAGTTTC
GAAGTAGCGGAATCCTTAACCTAACTCTGCTCCTTTCCACCACGCCCCCACTTCAACCCCCACCAACAACACCAATGGCTTCCCTTCCACCCCGATTCCAAAGCCAAGAAACGTTTCCAC
GCCCTCAAAGTTTCAGAGTCAAAGCCTGTATCCCACGCTCCTTTCTTGGCTCCACGTTCCCATGCATCTCCTTCAAGGCCATATGATGCAGACAAACGCAGCAGATTCGCTACTTTTCAA
TCTAGACACCTTCTACTCACTTCACCTTTAGCCCCACCAACAAGAACCACGGTTCTTCCTCCCAGCCCCAATCATCAATCGCCGCGACTCGCCTTCATGAACATACCTCGTCGCGGGGAA
GAAAATCGCGGAATTCCTCACTCCCTCGTGAACTTTCATCAATAATTTTCTTTTCCCCACCAGGCCCCCATTCAGCCCCACCAACAAGAGGTCTGCAGCTCTTTCCTCCACCTCATCCCT
AGACCCACAAACCGAAAGCTACGTCTATAAATCCTTCTCATATAAAAAGGTGGCGCAAATTGCTAAGAGCTTGAAATCATCTGTGCAGGCCCGCATTTCAACCCCACTAATAAGACCCAC
GGCAGCACCAGGGGACGATCAGCGCCACGTGGCCTACTTGGGCGAAAACATAGATGCACAACTCTGGTTTTGCGAACCTCCTGATATCACAAAGTTGTAATTTTCGGCCTTTTCCCACCA
GGCTCCTTGTCAACCCCACCAACAAGACCCACGTTTCTCCCTCCCACCCCCCATCATCGGTCGCGACGACTCCCCTTACATGACCATACCTCGTTGCGGAAAAGAAGGTCGCAACCTCAA
TTTTTTCTTTTTTCTTCACCAGGCCCCCATTTCAACCCCACCAGCAAGGACTACGGCGCGCCTAGCGACAACGGTCGCTACGTGGGCAACTTGGGCCCTCCAGTATATGCAGGAATCTGG
GTGTGCTGACCTTACAAAGGCCCCTGAAGTTGAATCATTTTACTATCTTCACCAGGCCCCCATTTCAACCCCACCAGCAAGACCCACGGCGCACCTGGCGACGAGGAGCGTCACGTGGGC
GACTTGGGCAACGTGATCGCCGGGGATGACGGCGTCGCCTCGCTCAAGCTCGATGACATCCAG
AGGTGGGCAGCCAATAGCGAATTTGCATATGGGCTCCTTTTTTACATGGTCGTGAAA
AACAGCGTCGCTAGATTTTAGGCCACCCTTCAAAGATTGGGCGCCCATACCGAATCCACCCGGGGGCTCGTTTCTTTGGTTTGTTGTGTTTGCTTGCCTATTACCAGCGTCCAGGTTTTG
CCTGGTCGCCGCGACGTACAACAATAAGCAGGGGGTCAGCGATAGGTTGTCCGTGCGACGGACTGTTTCTTTGTTTCTAACATTGTCCGCGCGTAGCTAAAACGGTCGCTGGCAAAACTA
ACCTGGCCGTGTGGAAGACAGACAAACCAGAAGGTTGGGCAACCTTAAGACTGGTATATCCGAATTTTGGACGTTTATAGTTCCGGACGGGCAAATCGAGGAGGTCGCAGCGAACCTTTT
GTACGACAAGTGCGGCGCAAAAGTCCCACCGATGGCTTTCTACGAAGACGGCCAGAAGACCGTGCAGCTCACGCAATTATTTTTCGATCTCGGACCAGCCAATCGAGTCTGTGGCTGGAC
GAGCGCGAGTAACACTTGTTTCGCTCGCGCCTTGTCTCCTGATGGTATTTTGAACGTGACATTGTAATCGATGCGTGAATTGGGTTCACTAAGCCCAGATTTCAAGTTTGCCGGTCCGAG
ACTAGAAATGTTTGAAGGCGGCCGCACCAGCCATATGTGATCTGGGCTTAGATTTGGTCGGATTGGGACACAAGACGAATGGGAGGCCAGTGACAGGGAAAAAGCTGACGAACTCCACTC
CGCTCGGTGCAGATTCCCCTGACCGGGCCCCACTCCATCATTGGCCGCGCGGTCGTGGTCCATGCTGATGTGGACGACCTTGGCAAGGGGGTAAGAACAACGCTTCTGTCAGTTCAACGT
CAGCCGTTTCTGGTGTGTATTCCTGTGGTTGTCCATCTTGTAATAGAGAGGGCGTCTTCCACTTCAGGAGTTACGTGCCGCCGCCCCACCTCCCTCCGGCCCCAATAAAGTGAGGAACTG
CGAGCGGCAACTCCGGAAGTCGATTCGTCAAGTTTGGAGTCGACGAAGTTGGGATGGTTTTCTGACGCCCTCTTTGCACGAAGCGAAAAATCCCGCGTGTTCATTGCATTTCTTCTGTCA
GCGCGCTCGACGTTGTGGTGGTAATGTAGTCTCCCAATTGGGGCGTTTGTCCTTCTGTCGATCATCGCACAGCAAAATCTGCAGATTTGGACTTGGGGGCGCCCCTACTTTTTTTCTGAA
GCCTCGTTTCTTTGGGCGGACGTCTCATGCGGCTGTTTGTTTCTATCTGGATTGACGATCTTATCAGCAGCTCAGGCTGTAGTCAGAGTAAGGAAAAAGCGTTGGTTTGAGAAAAGCGGG
GAAGAGGAGGAGGGTTGGGGGCGACTGAAAGGGAGAGAAGGGGGAGAGGGGACGGGAAAGAGACCTCGGAAATGCGGGGAGGAGGGAGGGGTTTGCGGGGATGGGCTGAAG
AGGTAAGGT
GGGAGGGCGGGGTATCCTGACGTTTCCTTCAGTTTCTAAGCTATGCATCATGCGTATGAAGCCGTGCTCTCTTCAGTATCTATTCGGAGTCAGCACCTTCGAGCCAATCTTCGATCCGGC
AGTGGTTTGTGTCTTGTAGTTTTCTAAACGCTTGTGTCTCCGCCCTTCAACTCGTCAGTACCAAAGCTCGCCCATCTCTCAATCCTGCGTGAGGTTGCCCCGAACCTTTCTCTTATTCTC
TCTGCGGAGGGAGTGCAGCTCAGCAGAGCTTCTGCCTCAGAACCTCTTTTCGGATAGTCGCTTTCTATGGTCTCAACAAACGCTCTCCTATTCGCTCTTTCCAGGTGGGCACGAGCTCAG
CAAGACCACTGGCAATGCGGGAGGCCGTCTTGCATGCG
CGGTAAGCTTCGGGTCGCATTACTGCCATTTTCCAGGATTTCTTTTGGTTTTCTTTTCGGCAAGGTCGAAGGAGCTAGTTTA
GGATTATGTGTTGGCTTTCATTTTGGCACCTTACACACACTCTGCTTGTCCTTGACGCGAATGATAGTCTGGCAGCCCTAGCGTTGAATTGAGTATGTACTAGAATTTTGGCATCGAGTT
CGTAAGTCAGCGGGCACCCTTCTACTTGTATCCCTGGAAACAAAGAGCATTTTGGGCAATTATGGCAGCAGCTGGTCCCCTTGTCTGGGCCCGCAGTGCCCGCGAGCTAAGTCGTAGTTC
CCATGCAAAAACTGTCCAGGCAGAGAGTCGCTCGCTGAATGCAAAGTTCTCTTATCCAGTGAACTCCCATTTGCCTCGTCGTTGCAGGAGTCGTTGGGTTAATGTCTCCCGTTTGACCGG
CTAGGCCGCTAGGGACATAGCATGTGGGCACTGCTTTTCGAGTAATCGTAAAATGAGATCGTTTGTCGACTCTTGTTTAGGAAGTACCTAGTAGAATTGCTGCAAGTCTCAAGACCGCTC
TTCATACTTGTGTTGCAGGCGTCGTTGGACTGGCTCAAGCTTAGTCTGGGCGGCGTAAAAGGAGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTCTTAAGGCGGTCGCCGTGCTGCAGGGTCAGAGCGATGTTTCAGGGACAGTCACCTTCACGCAGGATGGAGATGGTCCCACTCACGTGGAGGGGCAGATCAAGGGCCTGAAGCCG
GGCCCCCACGGTTTTCACATCCATCAATTGGGGGACACCACCAATGGCTGCATGTCGACCG
GCCCCCATTTCAACCCCACCAGCAAGACCCACGGCGCACCTGGCGACGAGGAGCGTCAC
GTGGGCGACTTGGGCAACGTGATCGCCGGGGATGACGGCGTCGCCTCGCTCAAGCTCGATGACATCCAG
ATTCCCCTGACCGGGCCCCACTCCATCATTGGCCGCGCGGTCGTGGTCCAT
GCTGATGTGGACGACCTTGGCAAGG
CTCAGGCTGTAGTCAGAGTAAGGAAAAAGCGTTGGTTTGAGAAAAGCGGGGAAGAGGAGGAGGGTTGGGGGCGACTGAAAGGGAGAGAAGGGGGA
GAGGGGACGGGAAAGAGACCTCGGAAATGCGGGGAGGAGGGAGGGGTTTGCGGGGATGGGCTGAAG
GTGGGCACGAGCTCAGCAAGACCACTGGCAATGCGGGAGGCCGTCTTGCATGCG
GCGTCGTTGGACTGGCTCAAGCTTAGTCTGGGCGGCGTAAAAGGAGCTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGGGCTT CTTCCGGAGT TGACGGGTTG TAGCCCTTTG TCAGGGGGCT GTGGGATCTC TAGGGTTCCC GCAAATCCAT CGATGTAGGA GCCCATCTGC TGCTTTCCTG CATGGCGATC  AAACTTTGAA CCTGCCAAGC TCCCACATTG CAAAAGTTGC TGCCGGCAAA AGCGCCACAC AAAGCACCAG GCCTCTTACA GTACATAGCT CGACAGGAAC TCATTGGGCA AGATGGTTCT  TAAGGCGGTC GCCGTGCTGC AGGGTCAGAG CGATGTTTCA GGGACAGTCA CCTTCACGCA GGATGGAGAT GGTCCCACTC ACGTGGAGGG GCAGATCAAG GGCCTGAAGC CGGGCCCCCA  CGGTTTTCAC ATCCATCAAT TGGGGGACAC CACCAATGGC TGCATGTCGA CCGGCCCCCA TTTCAACCCC ACCAGCAAGA CCCACGGCGC ACCTGGCGAC GAGGAGCGTC ACGTGGGCGA  CTTGGGCAAC GTGATCGCCG GGGATGACGG CGTCGCCTCG CTCAAGCTCG ATGACATCCA GATTCCCCTG ACCGGGCCCC ACTCCATCAT TGGCCGCGCG GTCGTGGTCC ATGCTGATGT  GGACGACCTT GGCAAGGCTC AGGCTGTAGT CAGAGTAAGG AAAAAGCGTT GGTTTGAGAA AAGCGGGGAA GAGGAGGAGG GTTGGGGGCG ACTGAAAGGG AGAGAAGGGG GAGAGGGGAC  GGGAAAGAGA CCTCGGAAAT GCGGGGAGGA GGGAGGGGTT TGCGGGGATG GGCTGAAGGT GGGCACGAGC TCAGCAAGAC CACTGGCAAT GCGGGAGGCC GTCTTGCATG CGGCGTCGTT 
GGACTGGCTC AAGCTTAGTC TGGGCGGCGT AAAAGGAGCT TAG 

Retrieve as FASTA