Entry information : KflCSD01 (kfl00283_0250)
Entry ID 13862
Creation 2016-08-23 (Christophe Dunand)
Last sequence changes 2016-08-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflCSD01 (kfl00283_0250)
Name (synonym) KflCSD01 (kfl00283_0250)
Class Cu/Zn SOD    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflCSD01
start..stop
S start..stop
PpaCSD03 122 2.13e-34 104..256 52..203
PpaCSD04 120 5.68e-34 140..256 80..201
LeCSD03 119 4.11e-33 83..256 41..214
MpalCSD01 117 4.4e-33 140..256 33..154
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13862' 'complement(join(108301..108354,109060..109173,109350..109481,110088..110194,110485..110851))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 110485..110851 365 N° 2 110088..110194 105 N° 3 109350..109481 130 N° 4 109060..109173 112
N° 5 108301..108354 52  
complement(join(108301..108354,109060..109173,109350..109481,110088..110194,1104 85..110851))


exon

Literature and cross-references KflCSD01 (kfl00283_0250)
Protein sequence: KflCSD01 (kfl00283_0250)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   257
PWM (Da):   %s   26070.19  
PI (pH):   %s   6.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACTVAIAFSGPAALTIGALVFRPEAAASVASSAVLPKSFWGLPVHAAPVPIHTRKLAVQAQCVGSFSEARAVGCQCGPECPRRDFLLGLALASAALAQPAEAAAAKVAVAKLVPTKGST
AF
GEVTFTESSGFFGGRKVKVDVNIGGLSPGMHGFHIEIGDVTCDDGLCTGGHYNPSKKPHGAPGSEERHVGDLGNIRADNDGKVQTTLEDVVISLDGPSSIVGHSVVVHFGQDDLESQP
SGNAGGRAAYATVRLV*

Retrieve as FASTA  
Remarks copper/zinc superoxide dismutase
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTGCACTGTAGCAATTGCCTTTTCAGGCCCTGCTGCCCTTACTATTGGTGCTTTAGTCTTTCGTCCAGAAGCGGCTGCTTCTGTCGCAAGCTCCGCCGTCCTGCCAAAGTCATTT
TGGGGCCTTCCCGTGCATGCTGCCCCAGTGCCAATTCATACCCGAAAGCTCGCAGTCCAGGCACAATGTGTGGGCAGCTTCTCAGAAGCAAGGGCAGTGGGCTGCCAATGTGGGCCTGAG
TGCCCCCGGCGAGATTTCCTCCTCGGCCTCGCCCTAGCCAGCGCAGCATTGGCTCAGCCAGCTGAGGCAGCAGCTGCAAAGGTGGCAGTTGCCAAATTGGTTCCTACAAAGGGAAGCACG
GCTTTTG
GTATGTCTCCTTCCATGTCTAGAACAAGGCCCACTGAATGGTGCTTTTTGAAGTCGCCCACAGCATGTGTTGTGAGAATCTATGCCAGGAGTGCATCGTGGCCGCTGTTGTTG
ACCGGATAGTCATTCGCAGCAGTTGCTTGAGCTCCTCTGAGGTGGTTCTTTACTTCTTCCGCAGGTATTGTTCCAGAGTCCTATTTATCATTGTAGAAGAACAATTTTTAGTGGGCTTTA
AAGCCCCCAAAATGTGGACCCCGTCAACGTAATTTGCATCTCCTGCTCCTTGTACAGGTGTGAAGTTACATTCACAGAGTCGTCGGGCTTCTTTGGTGGCAGGAAAGTGAAGGTGGACGT
CAATATTGGGGGTCTCTCCCCTGGTATGCATGGATTCCACATTCAT
GTGAGTCAGCTTGAGCAGACGCTTTAGTTTGGAGCGATGTACAGCTTCTTTCTCAGAACTCTGCTCCTTGGCGT
CTTGTCTCTCAGGATTTTGTCCCTTGGCAAAGAGTCTGCATTACTGTATGTGTTCTTTGCCTGATACTGGCAAGCAAACGAAAGTGAAGCCATGCAGGGCAATGAAGGGGGGGTGAAGAG
GGAGGGGCGGGGGAGGAGCGGGGGGAGGGGAAGGAAGGGGTAGGGGGGATGGGAAGGGAGGTGAAGGGGGATCGCTGACCCAGCCGTCCTTAGGTAGTGTCCAATGACCTGTGCGGAAGC
AACATCGGGAGAAAAGTCGGTCAACTTTCTGCGCCCATTGGAAGTCTGGCTAAAACAAACCGTTCATAGGCTCGTTACTTCAGCGCAAGCACTGACAAATGAACCAACTCATGTTTAGGC
AATGAACTTCGGCGCTCTGCTCCGTGCTGGCTCAAACTGACCGCGAGACAGAGGTGGTGGGACTGCTACCCCTGCCCATGTGTGCCTGTTAGAAATGAAGCCTGTGCTCGCAAAATAGTC
AGATGCTAGGACTGCTGCGGTTCTGTTCATACTGGTCTCGATGTCGCTGCAGGAGAGATTGGCGATGTCACATGCGATGACGGCCTGTGCACGGGGGGGCACTACAACCCCAGCAAGAAG
CCCCACGGGGCGCCTGGCAGCGAGGAGCGGCATGTGGGCGATCTGGGGAACATTCGGGCTGACAAC
GTAGGGCCAGCACAATGGCTGAGTTGCCGTCTGTGCCATCTGACCTGGATGTAA
CGAGGCCTGCATCAGATCAGCAAGACTCGACGGGTGGAAGGATTTAGGCTCAATACTTGGCCATATTCTTAATCAGAGACACTTCCCTGAGTTGTGCGCCTGCTCATCTGCCTGCCTTGC
AGGAGATGGCAAGGTCCAGACCACGCTGGAGGACGTTGTCATCAGCTTAGACGGGCCCAGCTCGATTGTGGGACACTCGGTGGTCGTCCATTTTGGTCAGGACGATCTGGAGTCTCAGGT
GGGGGTCGCCTTGACTGTGTAGATTGTTGTTGCTTGACGGCTTGGTTATCTTTTGGTTAGATTGATGGCCTGCATGCTTACCTCTGGCTTTCTGCGGGTGGGCTTGTGTTTCTTCCATTT
TTCGACTGGCTTCACCTTGAGCAGCTTGCTGTGATTCGATCGAAAATTGTGGGTCGGTGGGCAGGGTATCGAATTGACCCTTGATGCCTTGGGTGCCGGGGTTTCGATAGCTTACGCTCT
TTGCCCTCGTCAGAGCATGACCTCCACAACTCCAGTCGCTCCCGGCCTGAGAAATAAAGTCAATATCTTAACAAGAAGCAGACACTTACGCAGCTCCGCTAGGATCTTTGTGCTTAGCGG
CGTGGCCGCCACGTGGATAGCTGGCAGACTCGTTACAGAAAGGCAGCCCACGGTTGCCGGGGGTAACAAACAACTTTTTCATCAAGACTGTGACCAATGGCGGGATGGTTTCAATTCGTA
TTATATCGAGCCCTTCAGTCGTGATGTTATCTAAAAAGCTTAAAGTACCTTTGGATCTGATTGGATGGCCAAGCGGAGTACCGATTCAAGCAAACTTCCGTTAGTTTCCATTCCGGCGTG
TACTGTGGCCGTTCAGGTCCCGCTTCGTGCTTCTCTTGCTAGATATCTCGCTTCACGAGAATTCGGTCGAATTTAACGATGGCCCCACTCTGCTTCTTTGCAGCCCCATCAGGAAACGCC
GGAGGTCGAGCAGCGTATGCAACAGTGAGGCTGGTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTGCACTGTAGCAATTGCCTTTTCAGGCCCTGCTGCCCTTACTATTGGTGCTTTAGTCTTTCGTCCAGAAGCGGCTGCTTCTGTCGCAAGCTCCGCCGTCCTGCCAAAGTCATTT
TGGGGCCTTCCCGTGCATGCTGCCCCAGTGCCAATTCATACCCGAAAGCTCGCAGTCCAGGCACAATGTGTGGGCAGCTTCTCAGAAGCAAGGGCAGTGGGCTGCCAATGTGGGCCTGAG
TGCCCCCGGCGAGATTTCCTCCTCGGCCTCGCCCTAGCCAGCGCAGCATTGGCTCAGCCAGCTGAGGCAGCAGCTGCAAAGGTGGCAGTTGCCAAATTGGTTCCTACAAAGGGAAGCACG
GCTTTTG
GTGAAGTTACATTCACAGAGTCGTCGGGCTTCTTTGGTGGCAGGAAAGTGAAGGTGGACGTCAATATTGGGGGTCTCTCCCCTGGTATGCATGGATTCCACATTCATGAGATT
GGCGATGTCACATGCGATGACGGCCTGTGCACGGGGGGGCACTACAACCCCAGCAAGAAGCCCCACGGGGCGCCTGGCAGCGAGGAGCGGCATGTGGGCGATCTGGGGAACATTCGGGCT
GACAAC
GATGGCAAGGTCCAGACCACGCTGGAGGACGTTGTCATCAGCTTAGACGGGCCCAGCTCGATTGTGGGACACTCGGTGGTCGTCCATTTTGGTCAGGACGATCTGGAGTCTCAG
CCATCAGGAAACGCCGGAGGTCGAGCAGCGTATGCAACAGTGAGGCTGGTTTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCTTCACTA ATTACAAACG TGAAGAATTA ACAAATTTGC AATCCGTTCT CAAGCACTCT CAAGGACCAC CTAGGGTGCG AATCTGTACA GCTCTCCGCT TTCCAGTCCT CTTGTCCAGC  AGAATGGCGT GCACTGTAGC AATTGCCTTT TCAGGCCCTG CTGCCCTTAC TATTGGTGCT TTAGTCTTTC GTCCAGAAGC GGCTGCTTCT GTCGCAAGCT CCGCCGTCCT GCCAAAGTCA  TTTTGGGGCC TTCCCGTGCA TGCTGCCCCA GTGCCAATTC ATACCCGAAA GCTCGCAGTC CAGGCACAAT GTGTGGGCAG CTTCTCAGAA GCAAGGGCAG TGGGCTGCCA ATGTGGGCCT  GAGTGCCCCC GGCGAGATTT CCTCCTCGGC CTCGCCCTAG CCAGCGCAGC ATTGGCTCAG CCAGCTGAGG CAGCAGCTGC AAAGGTGGCA GTTGCCAAAT TGGTTCCTAC AAAGGGAAGC  ACGGCTTTTG GTGAAGTTAC ATTCACAGAG TCGTCGGGCT TCTTTGGTGG CAGGAAAGTG AAGGTGGACG TCAATATTGG GGGTCTCTCC CCTGGTATGC ATGGATTCCA CATTCATGAG  ATTGGCGATG TCACATGCGA TGACGGCCTG TGCACGGGGG GGCACTACAA CCCCAGCAAG AAGCCCCACG GGGCGCCTGG CAGCGAGGAG CGGCATGTGG GCGATCTGGG GAACATTCGG  GCTGACAACG ATGGCAAGGT CCAGACCACG CTGGAGGACG TTGTCATCAG CTTAGACGGG CCCAGCTCGA TTGTGGGACA CTCGGTGGTC GTCCATTTTG GTCAGGACGA TCTGGAGTCT  CAGCCATCAG GAAACGCCGG AGGTCGAGCA GCGTATGCAA CAGTGAGGCT GGTTTAGCTA AGCAGAGACC CGCAGGTAAA TACTGGGCTT GGTGAACGTA AGACAGGTTA GGAGGTTGCT  TCGGACCTCG AGGGAAGATC AATCGAGTCG TTTTGCACTC TGTTGACTCG ATCGGTTGAG CGTCGAGACG GACAAGCATG TGTCTGTCTT TTCGCAAGCA AGGAATCGAA GTGAAGCGGC  CTCGCTGGCA TTCAGAGGAG AGAAAGTTCA AATCCTGCAG AAGAAACACG ACGGTCGACC CAAATCGTTG CAAAAATCAA AGGAGTTGAG AGCGAATGAT GTTGCTTAAG CATTCCCTTA  GGAGTACATG ATCACAGCTA CCGAGACTTT GATAGTAAAG TGTACCATAT AGATGTGACA GTGAGCTGTC CGCGGGACGT GAATTTTGTC GATTGTTATA AGCCGGGAAT GAACATCTAA 
GTCTGTATAA CGGCCGAGAT GTATGCATCT AACGGCAAAT CATCCAGTCG GCCGCGGCTC GAC 

Retrieve as FASTA