Entry information : KflMDAR01 (kfl00169_0160)
Entry ID 13873
Creation 2016-08-25 (Christophe Dunand)
Last sequence changes 2016-08-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-25 (Christophe Dunand)
Peroxidase information: KflMDAR01 (kfl00169_0160)
Name (synonym) KflMDAR01 (kfl00169_0160)
Class Monodhydroascorbate Reductase    [Orthogroup: MDAR003]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflMDAR01
start..stop
S start..stop
MpMDAR03 562 0 88..539 35..484
MpalMDAR03 558 0 94..539 41..484
LeMDAR02 536 0 68..539 14..482
ThasMDAR01 516 1.49e-180 69..539 14..491
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13873' 'complement(join(113801..113920,114342..114382,114738..114800,115247..115335,115897..115991,116683..116754,117047..117127,117459..117548,117857..117958,118236..118325,118600..118684,118924..119042,119367..119438,119782..119865,120069..120168,120606..120928))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 120606..120928 321 N° 2 120069..120168 98 N° 3 119782..119865 82 N° 4 119367..119438 70
N° 5 118924..119042 117 N° 6 118600..118684 83 N° 7 118236..118325 88 N° 8 117857..117958 100
N° 9 117459..117548 88 N° 10 117047..117127 79 N° 11 116683..116754 70 N° 12 115897..115991 93
N° 13 115247..115335 87 N° 14 114738..114800 61 N° 15 114342..114382 39 N° 16 113801..113920 118
complement(join(113801..113920,114342..114382,114738..114800,115247..115335,1158 97..115991,116683..116754,117047..117127,117459..117548,117857..117958,118236..1 18325,118600..118684,118924..119042,119367..119438,119782..119865,120069..120168 ,120606..120928))


exon

Literature and cross-references KflMDAR01 (kfl00169_0160)
Protein sequence: KflMDAR01 (kfl00169_0160)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   541
PWM (Da):   %s   57556.9  
PI (pH):   %s   6.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTNLATACLCKISASLEATALCALIEQLTPTAAMAFARCSAAVGQVNLAPKAAFTLRQSSQLGAPLLSVSSFQGVSLTGVLTPHLQSRVSGRRSFSVSASSLNRNTEYVIVGGGNAAGY
AAKAFVDNDQAAGKLAIISS
EVAPYERPTLSKGYLFPIKGDAKPPRLPGFHTTVGTGGERQTPEWYEQKGIELLLGTTISGLDLSKKELTTSKGDTLSYKKLIVATGSTASRLPEKIGGA
LPGVNYIRNVADADGLVKD
QNAKKVVVIGGGYIGMEVSAAALAWGLDVTLIFPEPHFMPRLFTPGIAAHYHKLYESLGANFVTGASVERFEAGPDGRVAKAIASNKQEYDADLIVVGVGA
KPAVQLFLDAGLDEEAKGIK
VNDQLQSSNPDVYAIGDTAAFPIKILGSTSRVEHVDHARKSAAHVVKAILDGSGEGYDYLPYFYSRVFEHPGTARKVWWQFYGEKGEVVDVGDFDPKLAA
FWVDE
GTLKGVFLESGAPEFKLLPEIARMRPKIDIDELKKADTVEKALETVKKAMSV*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACCAATCTTGCAACAGCGTGTCTCTGCAAGATCTCGGCCTCTCTTGAAGCCACAGCATTGTGTGCTCTGATCGAGCAGCTCACGCCGACAGCAGCCATGGCCTTTGCGAGGTGC
TCAGCTGCGGTGGGCCAGGTCAACCTGGCTCCCAAAGCTGCATTCACTCTCCGTCAGAGCTCGCAGCTTGGTGCACCTTTGCTGAGCGTCAGCTCCTTTCAGGGGGTCTCTCTGACTGGC
GTTTTGACACCTCACCTTCAGAGCCGAGTGTCAGGAAGAAGATCCTTTTCGGTTTCTGCTTCTTCCTTGAACAGGAACACAGA
GTGAGTCTGCAGCACTATGTACATTCCCTTGAGATAG
ATCTTTCAGATGACTTGAGGAGCTTGAACGCAGATAGGTCCTTGGTGTTTGTAAATGCTGGAGTGTAGATTGCAATTGTGTTGGGTGTTGCCAGTATGCATGCAGTTCTGAAGTGCGGTG
TTTCTGGTCAGTAATCAGCACATACCACCAACTTAAGTGATGTCAATGGGGTCCTACCATTCAGGAATTCAACAAGGGTGACATAAATCCAGGCCTTTGCAGAAAAGAATCATCGAAGCA
TATAACGGCGAGGGGGTTAGTTCGGCACCCCCGGGGCCAACCCCGGCCTCAGGTGCATACACGAGAGTGCCCAGCAAACATATGTCACATTTTACTCTAGTAAGACCTCATTGCTCACAT
TAAGCGACTGTAACACCACTAATGCAAGGCGCTTGTGCAGGTGTATGTAATCGTGGGGGGTGGCAATGCTGCGGGATATGCGGCCAAAGCCTTTGTGGACAACGATCAGGCGGCTGGTAA
ACTTGCCATCATCAGCAGCGAA
GTGAGTTTGCTGATGACAGTAGTATACCATGGAGAAGATCTCAACAGCGCGATCAAGAACCTCATGTCTACGCGCAGATTGCTTTGGTTTAGGGCTGG
ATCGCGACTCCCCTCCTCGCATTGTCGCAGGGCGCCAATTCGGAATGTCGCATTCTTACAAATTCCCACAGTCGTGATGCCCTGACTCGCTAAGTACTTTGGCAGGAGAAGTGGCTCCAT
ATGAGCGGCCCACCCTCTCAAAAGGCTACCTATTCCCAATCAAGGGAGACGCAAAACCGCCACGGTTGCCG
GTAAGAAAGGGAATGGCTTTGCTGGTCTTACATTATGTTTCTGGTCCCA
ATTGTGAGAGATCTGAGTCTCAGGCAGCCTGTAAGCATGCTCAAGCTCGGTCCTACTTGAGACAACGACTTCACATGTCATCTGATTGCCGTGTTAAATCTGAAGTTGGAATGCAGAGAC
TCTCGAACAAAAGCCCGCACAAAAGCTTCACCCAAATGACGAGGGTAGGGGACGGGAGTAGCTCAACATCATCTGGTCTATCAACTTGACGTATATTCCTAGGTAGCCGTATGATTGAGG
TCATCAGGTTCACAATTGGCTATTGAGCTGACGAGAGTGCACTGTATATACCAGGGGGCTTTCATACGACTGTGGGGACTGGTGGCGAGAGGCAGACCCCCGAGTGGTATGAGCAGAAGG
GCATTGAG
GTATGCATATCTGATCTTTATCACACTGCAAAGATCTGCAACAAATAAGCACCCCAGTCCCTCAGTGCTGATGGAATCAGCCGGAATCCTCAGCCAGTAAAATTGGAGCTCT
GAGCCTGACCGATATGATCTCAAAGACTCTAGTGGATCACGAAATATCCACTAGATATTTCGTGGATATTTAGTGGATCATATTAGTGCGAAGGACCTTGGTTACTCCTTTGACTTCGCT
CGTTGCTGAATCTTATGCACGCAGTCTTCATAGCATGCTTTCATCGAGGTTCTCATCCCCGTTGCCAGACGTGTAAGCACATTCTTCTGCAGTTTTGCTGCTAGGAACAACCATCTCAGG
TTTGGACCTATCCAAGAAGGAGCTGACCACCTCCAAGGGTGACACGCTTTCTTACAAAAAGCTCATTGTTGCCACTGGGAGCACCGCCTCTAG
GTGACCACCGAGGCTTTCTGCACAAAC
TGAGGCTTCCCCGCATCGTCAGGTTGCCCGCTAATTCATGGTCGAGTCGAGATTGTGCAGTCTACGTCAAACTTTGTACTGCTTGAGCGGACGCAATTGATTGAGACGGGTTGGTGCTGT
CCGCTGTCCAGATTGCCTGCAGCAAGCTGGAGCTTCGTTAGTGTCTTTTATGACGACACTGACTCAGGCTTTGCGGCTTTCCACTTTGACAGATATTGCCCGAAAAGATTGGCGGGGCGC
TTCCGGGCGTCAACTACATAAGGAACGTCGCTGATGCGGACGGGCTTGTGAAAGACTTT
GTAAGGTTCCCGCCTTGGCATTCTCGCCTCCGCTCTTTACTTTATGAGAACTGTGGAGAAT
TGTGCATAGAAGATTGACATTGTGCACCGCGTGAATCTTCGAGCGAACTCCACGAAAGAAGGACGCGGAAGATCAACGCGTTTGCATGCCGGTTCTTGAACGGAGAGGGAGTCGAAGCTT
CTTTTCGGTGCGCGTTAGAAGGCCGTTCCTGTAGGAACTGCCAGATAGTCTACGTCGAATCCTCTTTCGACACTTTACTTTGTCTTTCCACAGCACAAAACGCGAAGAAAGTTGTAGTTA
TCGGAGGGGGCTACATCGGTATGGAGGTGTCGGCAGCGGCTCTCGCATGGGGTCTGGACGTAACG
GTGCGTTTCACCGTTCCGATCCACACTCTTCCGCAGAAAAGATTGTCAACGGGAC
TCTCAATGGAGGATCATCTGCACAGCTTTCGACTTTCTGATACAAGGTCTGATCTTAAGGTTGCGTGTAGACAAGTTCCCCTTGAAACCTACTTCTTGTCGCTTGCACTTTGATCAAAGC
TATCCGCTAGACTAGAACTGGAAGCTGAAAATGATAGTCAACCAGACTTGACGTTACACAAGGATGCATCCCTGCTGCTGCTGACGTCCTGTCAATTCGCAGTTTTGATCTTCCCGGAGC
CCCACTTCATGCCCCGGTTGTTTACCCCAGGCATCGCTGCGCACTACCACAAGCTCTACGAGAGCCTCGGCGCCAACTTCGTGACG
GTAAGCTAGGCGGCAAAGGCGCTCCGGATATTGC
TGACAAAGCCCGAAGATTAGCGAGACGTCACTTGTACGACAAAGAAGCTTATTAATATCAATGACATGGCACCTCATAATTCCTAGTTCCTCATAACCCAACAACTCGCCGAATATCTTT
CCTGATCCAACAGCTCTTGCTGACGCACCAGCCTTGGAGGACTTGACAGCTGCATTGCTACGTCCACTGATGCTGGGGCTCAAACGACTTCTCGCGGTCAATGAGCCCGACCGAGTACTT
TATGATCGTAGATTTGTGTTTCTTTCTCTTGCAGGGGGTGCCAGCGTTGAGCGTTTCGAGGCGGGGCCCGATGGGAGGGTCGCAAAAGCGATTGCATCCAACAAGCAAGAGTACGACGCA
GATTTG
GTGAGTAAGGGCTCGCCATCTACTGCCAACGAAGTTCTTTGCACAAGCTCAATGCCTCCCGTTTCGTGAGAAATGTAGTCGGAGACTGCAAATGAACGGTCGAGCCTTGGAGCC
TGGACTTTGCTAAGTCACGAAAAAAGCGAAGGGGTTATGATCTACATGTAGGGTCTGCCGGAGAGTGGGTGCCCACTTGAGCTCCGTCTGGCTGATGGGAAAGTATTGGCTGTATGAGGA
TCCAGATACGGAAAGAGATGCTGAACGGGAGTCAAGCCGGGGGCTTTCCGGAGCAGCTCCTCATATCAACGTGCTGATTTCGGTACTCGTGTCGCAGATATAGTAGTGGGCGTCGGCGCT
AAACCTGCGGTGCAGCTGTTTCTGGACGCGGGATTGGACGAAGAAGCCAAGGGGATCAAG
GTAAGCGGAAGATGTTTCAATACCGGAACCGTCGCTTCTGTTTTGGTTTTGTCTGAGATA
GGCGTCGAGCATAGCGCAGAGCGCCGAGTTACATCACATGAACTTGGACATTCCACAGGAGTGTCAGCAACAGAATGGGTTGTATCGTGAAGAGATTTTAGGAAAACCGTTCAAGTCAAC
TTATACGCCAACCTGTGTTATTCTGGCCGGCTCATAGGAACGAACATTTTGATCTGCATCATAACCCGCATGTCAGCCAAAAGCGCTGCCGAATGATAAGCTTCTGCTGCAGGTGTGAAT
GACCAGCTGCAGTCCAGCAATCCAGACGTATACGCTATTGGAGACACGGCCGCGTTTCCAATCAAA
GTAAGCCTTGGACCGGTTCGCGTTCTCTATTACTTAAGCCACAAAACCCCTACT
CTCTCACATACTTCCTGCAGCCGAAAGCATCAAGTATGGCAGTTTGGCTACCTAGAACGAGTCGGAGAGTTCTTTGGTCTTGGTAGCGAAAAGATGGACTAATAATCTGCGGGAAAGCAA
CCGCAGAAGAGCGGTGTCTCGTTTCACACGATTGCTTCAGGCCTTGCTCATGTCTTCCGTACACATCGATCGAGTGTTTGAGGTCCGTCAGACGGGGGCGCTGCCGTCTTCCTTTCTTTC
CTGTCAAAGATTTGGCTAGGTCTAGTTGACGGAGTCCTGATTTGACCTGTTCAACACTTCAGCATATCGGGGCTTCGCGCAAAGATGAAAAAAAGTGTCGTGAGAGTTTCGGACTAATGT
TCCACGTCAAAGTTTGCCTTAAGCGAGGGACTATCAACTCGTGAGGGCACTTATTCTGCATAAAATTCTGAATCGAGCGAACCGCTTAGGCCCTTAGGCATTCCCTCTTTCATTTGAGCG
CGATCGAGAGACATGCCGTCCCATGGGAAAGGTCAAAGGCTGCGAACAAAGTTCCAATTGCAGGAAAACAGTGTGCTTATAGAGTGTCATCAACCAGGGAACCAAGGCTCTTCTCGAACG
ACCGAAGTACTGATGGACGCGTCTTGCTGCCGTGCAGATATTCTGGGCTCAACGTCGCGCGTCGAGCATGTTGATCACGCCAGGAAGTCGGCGGCGCACGTTGTGAAGGCGATCCTAGAC
GGCAGCGGCGAAGG
GTAAGCCGCCCAATTCGCAAGTCAACGGGTAAAGAAGCTTTCTAAGCACATGGACTCAAGGCAACAATCAACCTGCACACCGCTCGTCAAACGATCGCTCGCAGAG
GGTTAAAGAGGGCGTCAGATTTCAATGCGCACTAGTGGCATCTGAGTCCTTAGGGGAATCCTCATCGGACGGACTAAAGTGCATCTTGGAATTTGTCCCGAGCGACCAGTATGCCCCATT
TCTGCGGTACATGGTCGCCGAGGCGTGACGGGTCACGGGACGCCCTCTTTAATGGCACCGAAGTTGTGGATCACGCCGACAAAAAAAGGGGCTGATAAAAAGTTGTCTTTCACGAAGGCT
CGCTCAGCCTCTTCGATCGGATTGCTTTACTTTTGTAGTAGAAACGGTTTGGAATTTAGCACAAAAGACGCGCTCTAGACAATAGCACCATCCTGTGAGCTTGCTCCCTCTCCGGGAACT
AGCAGCGCCTTCTGATTAGCCACGTCATGAACCGCCCAGTTGAACGTTCCCGGACTACATCGGCGGCTGAAGCTTCCCGGCAACTTACTTCCCAGGTGTACGACTACCTGCCCTACTTCT
ACTCCCGCGTGTTCGAGCATCCCGGAACGGCACGGAAGGTCTGGTGGCAGTTTTACGGCGAGAACA
GTAAGTTGGAAACAGAGTTCTTGCCCGTCTTTCTCTGAGTGGGGTGGCCGTCTT
TCATAAATAGTGCCCCGCAATTTGGGGCCAATGTGTCCGAACGTTGACTCCCAGGGAGTATGAGGATTCGTGGCGTTTCGTCTGCGTGTATCGGTTGACGCCCCTGCAGCTTTGCTAAGG
GTAGTGGAAAGGAGAAAGAGGAACCATAAGCGTTCGCGGGGTTTGCCGAGCTCGAAGATCACAGTCGTAAAAGCTAGCATTAATGTGCTGTTGTGCATGAGTTCGGATTTGCGACGCTTT
GAGAGTGACAACGTTGTCAGTCGTTTTGAATTCTCGGTTCACTTTCAAAGTTGCTTCTACTTTGAGACGTCGAACTTAATCTGGACTCTCGCAAGTTTCTACAACCTTTGAGATATGATA
GTCAGAAAAGTTTGGACTCTCCTGTCGCGCAGAGAGGGGGAGGTCGTTGACGTGGGAGACTTTGACCCAAAGCTGGCGGCCTTTTGGGTCGACGAAGGTAAACTCTCGCGCCGACTTCGT
TATCACTGATTACCCAATGATCATCCTCATCCAAGTCTACGGTGCTTGTCTTGGAAAGGTTTTAAAGCGTTGTCTTCTTACTTGCGCGTGCCTGTTATAATTGCGACAGCCTGGCTCAGT
ATTTGCATTTGCGTCATCAGTACGGCAGAAGGAGAGGCTGCTATCTCTAACCCTAATTCAGAATGTTTGACGTCCAAATCACGTTGACTAAGTAGGTTTGCTGGTGTTATTGTCGCTTGG
ATTGACTCTGTCCGTTTTCTACTTTCTGCGCATATTGAGATGCCGGGGCCCCTAATTTCGGAATACCAATTTGACAGATTTCATCATTGCAGGCGCACACTGAAGGGCGTCTTTTTGGAG
AGTGGGGCTCCCGAG
GTGAGGCCTTGCTGCAAGCATGGATCTATTCAATTCCTTTTCCGCCGAACTCTAACCATGAATGTGGGCAGCAGAATTCTGCAACGCAGGCACAGCAAACATGCT
GTCAGTTTTATGACAAGTCTGTGGCCCCTGGAATTGTCCGGGATGCTTCTCAGCCCTGAAAACTTGCTCGTTTCTGCAAGCGTGGCCGTCTCATGAAAGCTCGATATGAGCCGACCGCAG
CTTCTCAGTCCTCGAGTAGAGGATGAAACGGCTCGAGTTTGCAACAGTGCAGATCGCACTTGAATGAGGCGGCCAGGTTTCAAGAAGCCCGTTGTAAAACCACCTTTGGTAGCGTTGTAA
TAAAGCCACCCAGAATGTCCAGTCAGCCGACATATGCTTCAGGCATAAACCGATGGTCCGTTTCCACGACTTGCAGGAGAGTTCAAGTTGCTGCCGGAGATTGCGCGGATGCGCCCGAAG
ATCGACATCGACGAGCTCAAGAAGGCCGACACCGTTGAAAAAGCCCTGGAGACTGTTAAGAAAGCGATGTCCGTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACCAATCTTGCAACAGCGTGTCTCTGCAAGATCTCGGCCTCTCTTGAAGCCACAGCATTGTGTGCTCTGATCGAGCAGCTCACGCCGACAGCAGCCATGGCCTTTGCGAGGTGC
TCAGCTGCGGTGGGCCAGGTCAACCTGGCTCCCAAAGCTGCATTCACTCTCCGTCAGAGCTCGCAGCTTGGTGCACCTTTGCTGAGCGTCAGCTCCTTTCAGGGGGTCTCTCTGACTGGC
GTTTTGACACCTCACCTTCAGAGCCGAGTGTCAGGAAGAAGATCCTTTTCGGTTTCTGCTTCTTCCTTGAACAGGAACACAGA
GTATGTAATCGTGGGGGGTGGCAATGCTGCGGGATAT
GCGGCCAAAGCCTTTGTGGACAACGATCAGGCGGCTGGTAAACTTGCCATCATCAGCAGCGAA
GAAGTGGCTCCATATGAGCGGCCCACCCTCTCAAAAGGCTACCTATTCCCAATCAAG
GGAGACGCAAAACCGCCACGGTTGCCG
GGCTTTCATACGACTGTGGGGACTGGTGGCGAGAGGCAGACCCCCGAGTGGTATGAGCAGAAGGGCATTGAGTTGCTGCTAGGAACAACCATC
TCAGGTTTGGACCTATCCAAGAAGGAGCTGACCACCTCCAAGGGTGACACGCTTTCTTACAAAAAGCTCATTGTTGCCACTGGGAGCACCGCCTCTAG
ATTGCCCGAAAAGATTGGCGGG
GCGCTTCCGGGCGTCAACTACATAAGGAACGTCGCTGATGCGGACGGGCTTGTGAAAGACTTT
CAAAACGCGAAGAAAGTTGTAGTTATCGGAGGGGGCTACATCGGTATGGAGGTGTCG
GCAGCGGCTCTCGCATGGGGTCTGGACGTAACG
TTGATCTTCCCGGAGCCCCACTTCATGCCCCGGTTGTTTACCCCAGGCATCGCTGCGCACTACCACAAGCTCTACGAGAGCCTCGGC
GCCAACTTCGTGACG
GGTGCCAGCGTTGAGCGTTTCGAGGCGGGGCCCGATGGGAGGGTCGCAAAAGCGATTGCATCCAACAAGCAAGAGTACGACGCAGATTTGATAGTAGTGGGCGTC
GGCGCTAAACCTGCGGTGCAGCTGTTTCTGGACGCGGGATTGGACGAAGAAGCCAAGGGGATCAAG
GTGAATGACCAGCTGCAGTCCAGCAATCCAGACGTATACGCTATTGGAGACACG
GCCGCGTTTCCAATCAAA
ATTCTGGGCTCAACGTCGCGCGTCGAGCATGTTGATCACGCCAGGAAGTCGGCGGCGCACGTTGTGAAGGCGATCCTAGACGGCAGCGGCGAAGGGTACGAC
TACCTGCCCTACTTCTACTCCCGCGTGTTCGAGCATCCCGGAACGGCACGGAAGGTCTGGTGGCAGTTTTACGGCGAGAACA
AGGGGGAGGTCGTTGACGTGGGAGACTTTGACCCAAAG
CTGGCGGCCTTTTGGGTCGACGAAG
GCACACTGAAGGGCGTCTTTTTGGAGAGTGGGGCTCCCGAGGAGTTCAAGTTGCTGCCGGAGATTGCGCGGATGCGCCCGAAGATCGACATCGAC
GAGCTCAAGAAGGCCGACACCGTTGAAAAAGCCCTGGAGACTGTTAAGAAAGCGATGTCCGTCTGA

Retrieve as FASTA