Entry information : KflMDAR02 (kfl00196_0050)
Entry ID 13874
Creation 2016-08-25 (Christophe Dunand)
Last sequence changes 2016-08-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-08-25 (Christophe Dunand)
Peroxidase information: KflMDAR02 (kfl00196_0050)
Name (synonym) KflMDAR02 (kfl00196_0050)
Class Monodhydroascorbate Reductase    [Orthogroup: MDAR001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflMDAR02
start..stop
S start..stop
HaMDAR03 526 0 3..434 6..435
PpaMDAR02 520 0 21..434 44..455
LeMDAR03 515 0 3..434 5..433
PpaMDAR03 509 1.66e-180 21..434 23..434
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13874' 'join(49908..49952,51117..51188,51701..51833,52744..52862,53337..53450,54009..54114,54813..54937,55368..55493,56178..56399,57118..57360)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49908..49952 43 N° 2 51117..51188 70 N° 3 51701..51833 131 N° 4 52744..52862 117
N° 5 53337..53450 112 N° 6 54009..54114 104 N° 7 54813..54937 123 N° 8 55368..55493 124
N° 9 56178..56399 220 N° 10 57118..57360 241  
join(49908..49952,51117..51188,51701..51833,52744..52862,53337..53450,54009..541 14,54813..54937,55368..55493,56178..56399,57118..57360)


exon

Literature and cross-references KflMDAR02 (kfl00196_0050)
Protein sequence: KflMDAR02 (kfl00196_0050)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   434 (213)
PWM (Da):   %s   47335.34 (23771.0)  
PI (pH):   %s   5.81 (6.42) Peptide Signal:   %s   cut: 26 range:26-238
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSFKYVIVGGGVAGGYGAWEFTKHGLQPGELAIISKEKVAPYERPALSKGYLFPENPARLPGFHTCVGGGGPKGLPEWYKENGIELKLDTEVVKADLKSKTLTTDKGETIKYEKLIIATGAVINLKDFKMPGADADGIYYIREEEDAAKLYEAMQKHKGAKVI
VVGGGYIGCEVGAGLSLNGLDVTIVYPEPHL
MPRLFTPEIASFYEGYYEAKGIKVFRGRLAAAIVQHDGQPNIQCVRMKDGEELPADFLVVGIGARPRVGLFEGQLEMAKGGFKVDGNFK
TSEPDVYAVGDVAAFPLKMKDGELTRVEHVDNARKSVMQAVQAIKAEEKGESIPEYDYLPYFYSRVFK
LSWVFYGENVGDVVVWGREEAIKEGGKFGAYWVNDKKVVGAFLESGTPDDNK
LMSEVARKRPSVESQEELKSGLAFAAKI*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTCCTTCAAGTATGTCATCGTCGGAGGCGGTGTTGCAGGCGCGTAAGCTCAACTTTCTTATGGTTTGCAGAATTTTGCATAAGTTGCTTGCAAGGGTTGCGAATGGTCGCAATTT
TGATTCTGAACGTCTGCTAAATGTAAGGATCTAAAGCAGTAAAATGACTCTCTCTAAGAACTCTGTTGCTGCAAAACAGGTTTTCTCTGGCTCAGATCTTTGTTGAGAGCTAATAACGGC
AGGGAGTTTGATGTCCGAAGTGGTTTTCTGTCCAGGACGTTTTCATTGCTTTGAGTTGGTGATGTCACTTTCGCTCATATGATCCTTGAAAGGAGACTGAATGTAGCTTTTGTCTATCCT
GCTGCCTGTACATTTGGTGCGCAAGATTGGACTTCTATATTCACTAGTGGAAGGAAGAAAGTCATAGACGCTTTGTTGGGCTTGTTGATCTCGTTGCTGCAAACATATGTCTGACACTGT
TCTCTGGGGAAGCAGTCAGCAATTGAAGGGCTTGAATGTTTAGAAGTGTCAGGTTTTGCAGGATGTCTTTTTGAAACCTCGAATGCGCAGTCAGAGTTGAGAACTTTCTCATTGTGAGTG
TGCAAGGAGTTATACAGGGCTTTAAAGTGTGCGACGAGTCATGCTGTCTCGTCGCACCTGTACACCCCTCCAAAAAGTTGTTAGCACGGAGGCAAGTCAGTGAAAGGGCAAAAACACACA
AGTCATCAGACAATGGAAAAGACGGCAGCAGAATCTGTGACCACGAATGGGGGATGGCAAGCCTTTGAGTGGTTTCCCTAATTGTCGACGAAAGCGACAGAGTTTTGCAATGACTTACGA
TTCCAAGTCCAAGCGACAAAAAGTGACCTTTGTGTGACTGAGTTGGAAAGTACAGAATCTGAATGCCCTCCTGTTCAGATTTCTTGACTGTATATGATGCGCAACATGATCAACATCTTT
GATGATTGGTGGTCACGTTAGGACGGGCGATCTGGCGCTGTCTCAAAAGTATCCCCCCTCGTATTGAGGGTCTTTGAAGGATGCCGAAGAATCTCCAGTTGTCACCACTGTCAAGAAGCT
GAACTGCCCGCTCGCACCCTCTCCGAGCAGGCAGGTCGGTAGCCTAACACATCCTGGCAATGGCCTTTCCTACTCTTAAGCCGCCCTTTTCTAGTTTCTTGCACTGACTATGTGCTTGGC
TCTGTATGCAGGGGTATGGTGCTTGGGAATTTACCAAACATGGACTGCAGCCTGGGGAGTTGGCTATCATCTCCAAGGAGAAGAGGTATCAGTCAATTGTTTCCTCTTCTTGGGTCTGAT
TCTATTTGAGAGGCCTGGTTTGGACCTCTCCTTGAGCTGGCGCGGAATGGCAGAGGGTCGCATCTCAACAGTATCACAGGAGCTAAGCCTCAAGAGTGTCTGCACAGTTTTGCTCCTAAG
CAATCTCTAAGGGCAGTGGTAATTCTGTTACATCCATTTGTCGGGGATTCGTTCATATGCGCCATTTTGCAGACAGAGCAGTTCTTTTGGCTTATATTTTGAACGCCCGCTGCCTCCTTG
TTGCTTTCTGAAGGGGATGTATGTAGACTTTTCCTTCACACATACCCCGCTTTCCTGAAACTAAGGTTAGCGGTCTTCCAATAAATACCAGGTATAGAGTGCAGGCTGTCGCAAAACTCG
ATTTGGTCTTTTCGTGACAGTGGATTACATGGATACAATCTTACCACTTGAGGTTTAATCCTCTTGCCGGGGGAAATATGTTGAGCCTTTCGCGCACTGAAGAATATGTGTTTGCAGGTC
GCCCCCTACGAGCGCCCCGCTTTGAGCAAGGGCTACCTCTTCCCCGAGAACCCGGCCAGACTGCCTGGTTTTCATACGTGCGTTGGGGGGGGCGGTCCCAAGGGGTTGCCAGAATGGTAC
AAGGAGAACG
CGGTGAGCGGGAAGTGAGCCTTAGTGTTGTTATGTGTTTTCCGTTACGTTTCGAGCTCCAGTGACTTTGATTGAGTAGTAGGTGACTCCTCTGCATTTCAGCGCCTTCAG
GATATCCTTTGAAGGAGCCGCGCATGCTTGCATGGTTTCGTAGCCGAAGTAGTAGTTGATTGCAAGGGAACTACTGAGGCTTATGGTATGTGTTGAGGAGTATGGTACTTTTTGAGGATT
ACGGTATTTTTCGAGGAATATGGATCCCGCTTTGCCCGCACCATGGTGATTGCACCCCAGATTGACAGTCCGAGTACTCCTCCTTTGAAAAGTCGCAAACTAGTACTGAGTCGAGGGTTC
GACAGAGCGTACTGGCGAAATCTCGTCCATGTTCGGAAAGCCGCAGTGTCTTCTTGTATTGCATCGTGACAGGAACTCAGCTGAGCCATGGTCCGGAGTGGATAAGATGGGCAACTAAAG
CGAGCAGATTTGAGTCTGCATCACGATCTGGAGTTTGCATCTTTCCTTTGCTTAGAAGAGGCTTTTTACTTGATAGGCCACGCTGTATTGCAGCGCTTTTCTTTTTCTTTGTGTTGTGTA
TACGACTCGAGCGCAGCTTTCAAGCGGCGGGTTCCATGGGGCTGTGCAACGGCCGTGAACCTCTCTAGATTTTTTGCACGTCTTCATGCGTTTTCAATAAAAAGCAGTTCTTGGAGTAGA
AGCGCCCCAGGAAGCGCTCCGTCATCTTCTTAACTTCACCAACAATGAAGCCTTTTGTATGGCCTCAAGCGTTGACGATGCAGCCCAGTTCCTGGAGAAGAGTCGCCCCCGGAAGCGCTT
CGTCGACTACGCAAGCGCACCAACTTTCAAGCCTTTGCACAGGCGATAAGATGTTCTCATCCGTTACATGCGCTTTCGCCAGGTATTGAGCTGAAGTTGGATACGGAGGTCGTCAAGGCG
GACCTCAAGAGCAAGACGCTGACGACCGACAAGGGCGAGACGATCAAGTACGAGAAGCTGATCATTGCAACCGGAGCCGGA
GAGTGAGGGTCGCCACCATTTGTCAGAAATGCTCACTTT
ATTCTGCGTCACTCGCGGAAGCAGGGGGCTATCCCCTTTTTTCCAGAGTCTTCCTGATATTCCCCCCCGCGCTCAGGGTGACGACTTGGTACCGTCGAGATGTGGCTGCTGCTGAGACAA
CAATTTTCTCAAGGAGGCGAATGCGCTTGTGGGGCCGCCTTGTGCTTCTTCTGAAGATCACTTCTGCTTCTACTCTGTCCTTCATGTTTCCATGTCATTATTTGAGACGCTTGCTCAGCC
CCTGAAAAAAGCGACTTCAAGTCGGTGACCAGCTCTCCTTCAAGTCGGTGACCAGCTCTCAATGGCTTTTGATGGTTTGTGCTGTGTACTCACACAAGCTTGTCAACCTGAGCTAATTTT
GCTGCTGATATTACTTCGCGTTCGGCTGAAGATCTCATATTGGCTCTCCGGCTCATGGTCTGTCCGTTTTGGTACAGGTCATCAACCTGAAAGACTTCAAGATGCCTGGCGCTGACGCCG
ACGGCATCTATTACATCCGGGAGGAGGAGGACGCGGCAAAGCTCTACGAGGCCATGCAGAAGCATAAGGGG
GGGTGCGTGGCGCCGCTTTTGCTCACATTGCGCGTTCATTCCGAGTCTT
CGTTGTCTCATGCGGAGCGTGTTGTCAGTCACATTCTTCGTTGGCAGATACGATCGATCGGCGGTTCTTGTCTGCTTTGTGTCTACGATCTTCTTTTCCAAATGCCCTCGTATTGTCGGA
CGAAGTTTGGGTTGCGTCATTCGCCATTGAGGAATTGATTTTCACAAGCAGTGTCTAAAACTTGAGCCGCCTCTTGAAATTGCTCGTAGTTTATCATTAACACCGACTGAGCAGAAGGTA
TATGTCCGAAGATGCGAAAAAAAGGACTTTATTGAGTCTACTCGCTTCCTCCGGTTGCTGTGCATCGATTCTGCGACCCTGCATGGAGGCGGGCAGCAAACGGTCGTTCCATCAGCTGGT
TTTGTGACCGCACGTTCATTCAGCTGCTCACGTCATTCGTGCGGTCCATGTAGCGTGCCAGCGAGTCCGGTGCGCTTGCAAGGATGACAATTCTCAAGCAAACAGCACTTTACGGACGGT
TTTTCTGAATCTTCTCTCCGCTTTCATGCAGGCTAAGGTTATTGTGGTGGGCGGAGGTTACATTGGTTGCGAGGTGGGAGCGGGACTCAGCCTGAACGGATTGGACGTCACGATCGTGTA
CCCCGAGCCGCATTTGA
GAGTAAGCATCTTACTCTTCTTGCACGTGGGCTCAATCAGCCTGTCGTCCAGTTGTCATCAAATATTTGTGTGGTATTGTGTTGTCTTTCGGGGCGTCTATGT
TCCTATATGTTATCTTCCTGACAACTCCGTGCTTCTTGTGTTGTGAACTTTTTCGACCACTGCATCCTTTTTGAGTGGCGTCTCTTCCGGAACAAGTCTGTGCTTCGTGTACTGTGACTC
CTTTCGACCACTGTATCGTTTCTGAGGACCCAACGTTCAAAAATTCTTCTGGCAAGAAGTCGATGCGCAGCAGGTATTAGCGTATGAGCGTATAAAGAACTCGAGAGAGGGTCAGCAGTC
GTTCCAGCCCACGAGGCGGCGTTCAAGCAAGCAGTCGACTTTCAAGATGGAAAGCGACAATAACGTTCTGTAGTGACTTGAGGTTGACGGTTTCAGCAGCTCGTCCTCATACCGACGACT
TCCTCAGGATTGAGGCAACCCTTTTAAGGATACTTCTGAGAAAGACATTGGGGCGTGGGCCTTTTACCAACGCCTCACTTACTCGCCTCTTCGTCTATGTCGACCGCTAACATCCTTCCT
ACTTTCCGTGAGCGACGAAGCCGTAATAACACTGGTGTGCGTCTGAGGATGAGTCGGGTTGAAAAGTGGGTAAGTCAGGAAAGAAAAGCTGACTGGAATTCTGTGGAGTCTTCGCAGTGC
CCCGCCTGTTCACACCAGAGATTGCGTCCTTCTACGAGGGCTACTACGAGGCCAAGGGCATCAAGGTGTTCAGGGGCCGGCTCGCAGCCGCCATCGTCCAACACGATGGACAGCCAAATA
AG
AGGTGCCGCCAACCTGGCTTCCTACATTGGGCTCTTGGTTGGCGCGTTGTTTGCTTTCGTATCCTGTTTCAGTCGCAAGTGCAACTGCGCTCATACGCCTTTGCTGTCACTTTTCATC
TTCGGTCATTTGTGCAACTCAGCTTCGTCGCTTCGTTGTACTGATCCATTCCGCAGCCCTTCTTGTACTTGTCGTCTTTTCTCCATTTACAATCAGTTATGCATCTCCGCTCGCCGGTTG
ATTTGCAGATTCAGGGCGTGCATACGTGCAGTAGGGTTTTAGGGTCTCAGGGCTTTAGGATTTTAGGGGTTTAGAGATTAGGGTTCTAGGGAATGATCGCGGGCGGCCTCTGCACAGACC
CGGTCAAAGATAGGTCTAACCGCTTCTTCCGTCGTTAACACTTGTTCACTTCCGGTCGCCCCTTTCTCGTGCAGATCCAGTGCGTGCGGATGAAGGACGGGGAGGAGTTGCCGGCCGACT
TTCTCGTGGTGGGCATCGGGGCGCGCCCCAGAGTGGGGCTTTTCGAGGGCCAGCTCGAAATGGCCAAGGGCGGCTTCAAG
AGGTCAGCACTTCGGTAATTGCCGTACTTCGGAGTTAGGA
TCTCGCATTTGCGAAGCTGAGCACTTGGGTTACGAACGTGCTATGGCGTTGGCAGAACTGATTGTCAGAAGCGAGAGGACTTTTGACATTTCTCGTCCGTTTTCACTCATGGCAAACTAA
TCTCAGAAAAGGAGACGAGCGATTATTTCGTCAGAATAGGAAAAGCAGTAGGTGACGTCGGCGAAACAGGCAGGGATAGGGGATCTTATGAGAGGACCGAGCAGCAGAGGCTCACGCTGC
TTGAAATTTACCTTTTACGTTTTCTGAGACCTTATCGGTGGTTGTCTGCACTAAAGGTCTGAACAGCTGCGACGGATGCTAAAAAGAAATTGCGGATGGTAGCATGCATTAACCATTGCG
AGGTGTCCAGCAACTAGTCTTCAGTCCTTAGCATACCACACTTTCATGACCCGCTCAACCTTTCGGGAAGGACTCTGTCTTACCTTTATTACGAGGAGCACGTTTCTCCGGAGTAGCGAG
GCGTACAAGGAGATCACAATCCCCTTCTGCTGGAGATCTAGGCACCTCCCAAAAGGCAAGTCTTTGCAGATTGTCCGCTTTGTTAAGTTTAACAAACTTCAGTCGGTATTTAGAAGCGGA
GACCTTCCACCCATTACCATCTCCTTACGTCCTGTTTATCATTCAGGTGGACGGCAATTTCAAGACGAGCGAGCCAGACGTCTACGCGGTGGGTGACGTGGCGGCGTTCCCGCTGAAGAT
GAAGGACGGCGAGCTGACACGTGTCGAGCACGTGGACAACGCGCGGAAGAGCGTGATGCAGGCGGTGCAGGCCATCAAGGCGGAGGAGAAGGGCGAGAGCATCCCCGAGTATGACTACCT
GCCGTACTTCTACTCCCGCGTCTTCAAG
AGGTACGGGTTGTATATTAAAGACGGATGTGTTTCTAGGTCCGAAAATCTTTGGTTCCTTTGCACATTTTTTTGGTGCAAAAAGACAAAAAG
AGTCGCACATCTTCAGAACGTCAGTCGTTGCTCGCGTACGACTCCCTGGCGTAATAGATTCTGCTCCCGCGCGCGTAAGGTATGGATCACGTTCCAAAGATTTTTAAAGTTCTGCGTGTC
TCTGAAACTCTAGGTTCCTATCGTGGTTCAAATAACCTGTTAAGGACGGCAGAAGGACAGGCGTAGGGAACTTCGGTCGCCCGACGAGTCCGATTTATCTTTCGACTCCTTGTCAAGACT
CACTAGAAGAAAACAGTGGGATCGCAAGCGCAAGTATCGAATACTCTTGCTTCGTTTTCACTCCTGCGGTCGTAGCATGTTTTCAACAGCAGTCTGGGAAGGGGAGTCGATTTGTCATGC
AGTCTTCATCCAGACCTTGGATCGTGCAGTTTAGAACTTACCCAGATCAGTGCTTTATGGTCGGAAGACTGGTTGCGCTTTGAGACAGAGTGTTCCTAAGGTCTTCTTTCAGCCTTCCAG
CCCCTTCCAGATCAAAGAATTGCATTGCAGAGACCACACCGTCTAGAAAGCTTCTTCGCTTGCCGGCTTGCACTTACGGTCTGCCTTCATTCTTAATTCAAGCGGAAGCAAATTTCTTAT
AAACGTAAACTCGGTGGCTCGCGTGCAGTTGAGCTGGGTGTTTTACGGCGAGAACGTGGGCGACGTCGTTGTGTGGGGCCGCGAGGAGGCGATCAAGGAGGGCGGCAAGTTTGGCGCCTA
CTGGGTCAACGACAAAAAGGTGGTCGGGGCCTTCCTCGAGAGCGGGACGCCGGACGATAACAAGCTGATGTCCGAAGTTGCGCGGAAGCGACCGAGCGTTGAGTCTCAGGAGGAGCTCAA
GTCGGGGCTAGCGTTTGCGGCTAAAATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTCCTTCAAGTATGTCATCGTCGGAGGCGGTGTTGCAGGCGGGTATGGTGCTTGGGAATTTACCAAACATGGACTGCAGCCTGGGGAGTTGGCTATCATCTCCAAGGAGAAGGTC
GCCCCCTACGAGCGCCCCGCTTTGAGCAAGGGCTACCTCTTCCCCGAGAACCCGGCCAGACTGCCTGGTTTTCATACGTGCGTTGGGGGGGGCGGTCCCAAGGGGTTGCCAGAATGGTAC
AAGGAGAACG
GTATTGAGCTGAAGTTGGATACGGAGGTCGTCAAGGCGGACCTCAAGAGCAAGACGCTGACGACCGACAAGGGCGAGACGATCAAGTACGAGAAGCTGATCATTGCAACC
GGAGCCGGA
GTCATCAACCTGAAAGACTTCAAGATGCCTGGCGCTGACGCCGACGGCATCTATTACATCCGGGAGGAGGAGGACGCGGCAAAGCTCTACGAGGCCATGCAGAAGCATAAG
GGG
GCTAAGGTTATTGTGGTGGGCGGAGGTTACATTGGTTGCGAGGTGGGAGCGGGACTCAGCCTGAACGGATTGGACGTCACGATCGTGTACCCCGAGCCGCATTTGATGCCCCGCCTG
TTCACACCAGAGATTGCGTCCTTCTACGAGGGCTACTACGAGGCCAAGGGCATCAAGGTGTTCAGGGGCCGGCTCGCAGCCGCCATCGTCCAACACGATGGACAGCCAAATAAG
ATCCAG
TGCGTGCGGATGAAGGACGGGGAGGAGTTGCCGGCCGACTTTCTCGTGGTGGGCATCGGGGCGCGCCCCAGAGTGGGGCTTTTCGAGGGCCAGCTCGAAATGGCCAAGGGCGGCTTCAAG
GTGGACGGCAATTTCAAGACGAGCGAGCCAGACGTCTACGCGGTGGGTGACGTGGCGGCGTTCCCGCTGAAGATGAAGGACGGCGAGCTGACACGTGTCGAGCACGTGGACAACGCGCGG
AAGAGCGTGATGCAGGCGGTGCAGGCCATCAAGGCGGAGGAGAAGGGCGAGAGCATCCCCGAGTATGACTACCTGCCGTACTTCTACTCCCGCGTCTTCAAG
TTGAGCTGGGTGTTTTAC
GGCGAGAACGTGGGCGACGTCGTTGTGTGGGGCCGCGAGGAGGCGATCAAGGAGGGCGGCAAGTTTGGCGCCTACTGGGTCAACGACAAAAAGGTGGTCGGGGCCTTCCTCGAGAGCGGG
ACGCCGGACGATAACAAGCTGATGTCCGAAGTTGCGCGGAAGCGACCGAGCGTTGAGTCTCAGGAGGAGCTCAAGTCGGGGCTAGCGTTTGCGGCTAAAATCTGA

Retrieve as FASTA