Entry information : KflFer04 (Kfl_000930280)
Entry ID 13898
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-14 (Christophe Dunand)
Peroxidase information: KflFer04 (Kfl_000930280)
Name (synonym) KflFer04 (Kfl_000930280)
Class Ferritin    [Orthogroup: Fer004]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflFer04
start..stop
S start..stop
KflFer03 276 1.5e-93 104..311 10..217
CbraFer03 182 4.6e-57 96..303 7..213
CbraFer01 175 1.23e-53 80..304 30..250
HaFer06 172 1.29e-52 102..298 46..239
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13898' 'join(144415..144726,145588..145718,146065..146209,146681..146768,147174..147235,147618..147683,147968..148032,148442..148541)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 144415..144726 310 N° 2 145588..145718 129 N° 3 146065..146209 143 N° 4 146681..146768 86
N° 5 147174..147235 60 N° 6 147618..147683 64 N° 7 147968..148032 63 N° 8 148442..148541 98
join(144415..144726,145588..145718,146065..146209,146681..146768,147174..147235, 147618..147683,147968..148032,148442..148541)


exon

Literature and cross-references KflFer04 (Kfl_000930280)
DNA ref. GenBank:   DF237042.1 (144415..148541)
Protein sequence: KflFer04 (Kfl_000930280)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (513)
PWM (Da):   %s   35884.3 (54079.7)  
PI (pH):   %s   6.52 (4.25) Peptide Signal:   %s   cut: 21 range:21-533
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPASLMRIVFPLLSRNSSNFLRSGVLLNGPPSFWQLESVSKFS
TLVRSSNLSGLPKANKLWTNEAAELIPERLVTSCALAAISGRPKIELVLERGAHNEAGK
VYDVLSEVNSVGLENLVPADGTKESIVRQEWPSKLESGLNDMINVSYSISYALHALSSYCSRDYVSLRGLARWYIDRSNRERADALELSRYSLRGGKTMLCPIGESQTDFDHDQKGDALYTMELVLAMYKLQEQKFRDLALADEEGDQEFSDFITDSFLSHLTVLVKKTAGYVAQLRRVGKGHGTWHFDHYLHKKLEGDHVGDELRTGLHELEGTK

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGCCAGCTTCGTTAATGAGGATCGTCTTTCCGCTTCTGAGCCGGAATTCTTCGAACTTTCTGAGAAGCGGAGTCCTTCTCAACGGCCCGCCAAGCTTTTGGCAGCTCGAATCG
GTCTCAAAGTTCTCTACTCTGGTTAGAAGCAGCAATCTGAGCGGCCTTCCAAAGGCCAACAAGCTATGGACGAACGAGGCAGCTGAGCTCATCCCTGAGAGGCTTGTGACGTCATGTGCC
CTTGCTGCAATCAGCGGAAGGCCAAAGATCGAGCTGGTACTGGAGAGGGGCGCCCATAACGAGGCTGGGAAG
AGGTGAGACTTCGTGCTTCCCAAGACCCTGAAGGTGAATCTAGAAGAT
GGCGATCTGGTTAAGTTTCCAGTCAGATAGGGCAACATGCTTCATGAGTTGCTGGATTGCCTGTCCTGAAGGCAATGCTGTTAGGATGCTCTAATTCTTTGTAAGGGAAGCTCCTTTGAT
TGCGAATTGCACTCAGAACACCCGTGGAGCACAACAAATAGAGATGCTTTGTGTAACCAGAGCTTTTGAAGAAAGTTTTTCTCGTGCTACTAGGTTGCAGCTCCTGGGTTCAGATCATAG
CAATAGCTTTTGTAGAGCAACTAGTGTCATTTTGAACAAATGTTTCTGGGTTAGCGAAACCTGAGACTGACTTGCTTTCAAAATCGAAGGATGGCGAACAAGTTGTAATACGACCAACTT
CGACCAAGCCGGAGAAAATTGCAGATTTTATCAGAATGCAGACAGTTGCGGAGAACGGTTTACAGGTTACCATCTGGAGAAAACTCGCTCAGATAGCACCAGAGCTCTAAGTCAGAAAGT
GGGACCAGAATGCAGTATTTAACCACGTATGGGGGAAAAAATCTGAAGCTGACAAGGTTTCGAGGGAAGTGGTCCTTCAAAGGAATCCTTGCTTTCGGCTATTGCAAGATCCGCTTGCAA
TTGGTCAAAATCCTCCGGCTAGCATCCCTCTTCCACCCTTTCACTGTCTTTGAAGTAGTGACCTGTTTCCACGAAAGAGATCAACCGTTGTTGTTGGATACATTTTTAAGGTCGGAAGGG
TAATCCTCCTACTTTGGATTGGATTATAAGCAAACGCCCAACATATCTTCTCAATACGGATCGTGATCTTCGTACTTGTACCCGTTGCTCTTCAGGTGTACGACGTCCTGTCCGAAGTAA
ATTCCGTCGGGCTCGAAAATCTGGTTCCCGCTGATGGTACGAAGGAGAGCATCGTCCGCCAGGAGTGGCCGAGCAAGCTGGAGAGCGGTCTCAACGACATGATCAA
AAGTAAGCCAGCAG
TTAGCGTGCAGCTAAAAAAGTTGCACAGTCAGTCGAGTAAAACTGCTATTGTGTTGGCCTGTGCCTTGCAAAGGTTCCCGTCTTCTTTACACTTCGTTTGCGTTTTCGGGCATCACTCTG
CGAATGACAGACAAGTCTTTGAGCAGCACATTCCGACCTCACTCCGTTTCCATCGTTAAAAAGTAACGCGTTCACCGCAAAGTCACGCGTACAGAAATCCTCAAGCTCCTGAAAAAGGGA
GGATGCGAGCAGAGATAATGCACGAAGAGCAGAAGAGCCAGGACTTTCTTCGAACTGATTCGACGACATTTTCCGCCCCCGTTTTTTCCCGCAGCGTGTCCTACAGCATCTCGTATGCTC
TGCACGCCCTCTCGAGCTACTGCTCGCGCGACTACGTCAGCCTGCGCGGCCTCGCGCGCTGGTACATCGACCGCAGCAACCGGGAGCGCGCGGACGCGCTCGAGCTGTCGCGCTATCAG
A
GGTGCGAAATGCGCGGATTCTAGGTCGTAATGTTCCAATCCACAATACTGTCGAATTAGAAGCGAAGAATGACGCAGAGGGGTTTTGAAGACACCTGTGTCCGTCAAGGAAGACGTCTTC
GAATCTGCCCGAGTAGTGTTCGTAATTTGCAGCTTTTTCCGGGTTTCAAGCGGCACCTCACATCGGCTCTTAAAAACAGAAGATTTGCTTTGTCTGCTCGATTGATTGCCCGTCGATCCT
CTTGCAGTTGCACTTTCGGTCGAAGTTCGAAACGTCGCTCTTGGTCTGCTAAGTTCCAGGTTTATTTTCTCGTGAGCTGGGAGAGCCTACGGTCGCCAAAAGAGCGCGTTTGAGGCGCCC
GGGGATTTTTTTTGAAAAATGTTTGTGTTTGCATTCTTTGTGACGGCCATGTATCGGGACGCTTCATCTCTAAAACTCGGTCCGCCATAGACAAGAAGGACGTCGTCTGCAGAGTCTCCG
TGGCGGGAAGACGATGCTCTGCCCCATCGGCGAGTCCCAGACCGACTTCGACCATGATCAAAAGGGCGACGCCCTCTACA
CAGTAAGACTTTCTGACCTTGCGTGAAAAGAAGCCTGACC
TCGTTCGCTCACGCCCCTGTCCGAAGCAAAAAAAACCTGCTTTAGCACACGTTGATGCATCGGTGGAGATCTTGTCAGAACAGATCTGCGACAAAATGGGTTTATGGCTACTTGATTAGT
TTTGAATTTTCCTCAAGACTTCGTGGCATAAGAAGAAAACTGAGGGGTCTGTCTTCAATGGCAGCCGTGGTGCAGCGACGCTGTTCCGCCAGACGTCGTATCCAACTTCGGACGAGGCTG
GTCGGAGTCTAGCCGGCCGACAGGTTGGCTTGCGGACCTCACTTGCACCAGTTTCAGGCGGCACCAAAGTCTGGGACGTTTTGAGAACCAACAGTCACTGAGATGTCACGTCGTCCTTTG
CGTGCAGCGATGGAGCTGGTTCTTGCCATGTACAAACTCCAGGAACAGAAATTCCGAGACCTGGCGCGGGGGTAAGTCTCACAACCAACGACTATATTGTGTGGTATGGACATGGCACAA
AGTGAGCTGAAAGCAGTCTTCCTGTGGTCGTATTTGACATCAGAACATTGCCCTTGAAGCTAGGGAGTAAAGGGCTGCAAGGTGCACAGGTTGCGAGTTGATTCCAGGTACCGGACCGCC
CCCGACCTCACCGTTTTCATGTTAGTCCGCGACCTCAGATTTCGGTGCGATATTGGGAAAGAGCTCAGATTTTGGTGCAATATTGGGAAAGAGCTTTGAAAGCTGGTGCAAGGGGGTAAT
TTATAAACCGTTCTTCAGACACAGCCGAAAATTTGAAGAAGGTCATCTGGTGTGAATCAGCTTCAATGAGGAGAAGGGTGTTTCGATGTGCAGCTAGCAGACGAGGAAGGGGATCAGGAG
TTCTCGGACTTCATCACCGACAGTTTTCTCAGCCACCTG
TGGTACGTTCCACCTCTCCTCACGAATCTCTTTCTCTCCCGTGCAATCTTCGCTTATGCGATTCGAGGACGAGGTTCGAAG
TTACTAGTATCGTTGCGTGGCTGAGGGCTCTCCGTGAGATCCTTGAGGGCTCCCCTTTTCTGCCTTTGTCTCGTGTGCGGTACACTTCCCCTCCGACTCTGACGATTTAGGATGTCGAAG
TGCTCTCGTAGTCAAAGCCGTGGCAAGTTGTCGATGAGACGAAGCGCTATTCCCTTCTCAGCGTGCGCCACGTGTCGATGTGCAGACCGTCCTCGTGAAGAAGACCGCCGGCTACGTGGC
GCAGCTGCGCCGCGTCGGCAAGGGGCACGG
GGGTAAGAGCGTTACTAAAAACCCGCTCATGGAGTCTCGTAGGCTTTGACTGGAACGCGGCCTCGCTCCTAGCTGCGCAGTAACATTACT
TGAACCGAGAAGCCACGACATAGGTCATTGCGGATGCTCTCTTTTTAAGAGATGGATGGCCTTTTCAATGGGCCTTCCCCACCTCTACTTTCTGGCTCCGCCAAGTTGACCATAAGGCCC
TTGAAGACCAGGGCTTCTGGTAAGAGGTCGAAGATTAGGAGAAATTAGCCTTTGTCGTGAACCTTATTCCGTCCTTGTTCGTGGCCGACGTAGAGGCCGCAAGAAAAGGAAGCGGGGATG
CCCCCCCGCTCAAGAACAGAACAGGGCGGTTACGTCTACCAGGCAGTGACCGGGCTAACTAACGCACCCCGCTTGCCGCAGCACGTGGCACTTCGACCACTACCTGCACAAGAAGCTGGA
AGGGGACCACGTGGGGGACGAGTTACGTACCGGGCTGCACGAACTTGAAGGGACGAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGCCAGCTTCGTTAATGAGGATCGTCTTTCCGCTTCTGAGCCGGAATTCTTCGAACTTTCTGAGAAGCGGAGTCCTTCTCAACGGCCCGCCAAGCTTTTGGCAGCTCGAATCG
GTCTCAAAGTTCTCTACTCTGGTTAGAAGCAGCAATCTGAGCGGCCTTCCAAAGGCCAACAAGCTATGGACGAACGAGGCAGCTGAGCTCATCCCTGAGAGGCTTGTGACGTCATGTGCC
CTTGCTGCAATCAGCGGAAGGCCAAAGATCGAGCTGGTACTGGAGAGGGGCGCCCATAACGAGGCTGGGAAG
GTGTACGACGTCCTGTCCGAAGTAAATTCCGTCGGGCTCGAAAATCTG
GTTCCCGCTGATGGTACGAAGGAGAGCATCGTCCGCCAGGAGTGGCCGAGCAAGCTGGAGAGCGGTCTCAACGACATGATCAA
CGTGTCCTACAGCATCTCGTATGCTCTGCACGCCCTC
TCGAGCTACTGCTCGCGCGACTACGTCAGCCTGCGCGGCCTCGCGCGCTGGTACATCGACCGCAGCAACCGGGAGCGCGCGGACGCGCTCGAGCTGTCGCGCTATCAG
AGTCTCCGTGGC
GGGAAGACGATGCTCTGCCCCATCGGCGAGTCCCAGACCGACTTCGACCATGATCAAAAGGGCGACGCCCTCTACA
CGATGGAGCTGGTTCTTGCCATGTACAAACTCCAGGAACAGAAA
TTCCGAGACCTGGCGCGG
CTAGCAGACGAGGAAGGGGATCAGGAGTTCTCGGACTTCATCACCGACAGTTTTCTCAGCCACCTGACCGTCCTCGTGAAGAAGACCGCCGGCTACGTGGCG
CAGCTGCGCCGCGTCGGCAAGGGGCACGG
CACGTGGCACTTCGACCACTACCTGCACAAGAAGCTGGAAGGGGACCACGTGGGGGACGAGTTACGTACCGGGCTGCACGAACTTGAAGGG
ACGAAGTAG

Retrieve as FASTA