Entry information : PpaGOX02 (Pp3c22_7690)
Entry ID 13908
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-14 (Christophe Dunand)
Peroxidase information: PpaGOX02 (Pp3c22_7690)
Name (synonym) PpaGOX02 (Pp3c22_7690)
Class Glycolate Oxidase    [Orthogroup: GOX001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaGOX02
start..stop
S start..stop
PpaGOX01 711 0 1..368 1..368
PpaGOX03 698 0 1..368 1..368
MpalGOX01 637 0 3..364 5..366
MpGOX01 635 0 4..364 6..366
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 579..724 146 N° 2 853..1427 575 N° 3 1554..1759 206 N° 4 1901..2080 180
join(579..724,853..1427,1554..1759,1901..2080)


exon

Literature and cross-references PpaGOX02 (Pp3c22_7690)
Cluster/Prediction ref. Genebank:   5917397
Protein sequence: PpaGOX02 (Pp3c22_7690)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368
PWM (Da):   %s   40335.34  
PI (pH):   %s   9.76
Sequence 410
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATAEVTNVTEYEELARQKLPKMVFDYYASGAEDQWTLRENRNAFERIRFRPRILIDVTKVDLTTNVLGFNISMPIMVAPTAMQRMAHPDGELATARAVSKAGTIMTLSSWATSSVEEVASVGPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFALPSHLTLANFEGLDLGKMDKTQDSGLASYVAGQIDRSLSWKDVKWLQTITKLPILVKGVITAEDTQLAIQSGAAGIIVSNHGARQLDYVSATISALEEVVLAARGRVPVFLDGGVRRGTDVLKALALGASGVFVGRPVVFGLATDGQKGVEKVLQMLRDEFELAMALAGCTKVSDIKRSHIQTEAERLYSKL*

Retrieve as FASTA  
Remarks (Chromo 22, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGACTGCCGAGGTTACCAATGTGACCGAGTATGAAGAACTCGCAAGGCAGAAGCTCCCGAAGATGGTGTTCGACTACTACGCTTCAGGTGCTGAGGACCAGTGGACCTTGAGAGAGA
ATCGCAACGCTTTCGAGCGTATCAG
GTATGTCGTGTCGCGCCCGAATGTGTGCATCCTCTCCACTTTCTAGTTGTGATCACCATGACAGTGCTGATAAAAAAATCTCTGCGACTTTCCCA
GCTTGGAATTCATTAACTGTGATAAGTATGCAGATTCCGGCCCCGCATCCTCATCGACGTTACGAAGGTGGATCTGACCACCAACGTATTGGGCTTCAACATCTCCATGCCCATCATGGT
CGCTCCCACCGCCATGCAGAGGATGGCGCACCCGGACGGTGAATTGGCCACCGCCAGGGCTGTTTCAAAAGCTGGGACGATCATGACGCTGTCGTCGTGGGCGACCAGCAGCGTGGAGGA
GGTCGCGTCCGTAGGACCTGGCATCCGCTTCTTCCAGCTCTACGTGTACAAGGATAGGAACGTAGTCGCCCAGCTCGTACGCCGCGCTGAGAGAGCCGGCTTCAAGGCCATCGCCCTTAC
CGTCGACACCCCTCGCCTTGGACGCAGAGAGTCAGACATCAAGAACAGATTCGCTCTGCCAAGTCACCTCACTCTCGCCAACTTCGAGGGTCTGGATCTCGGAAAGATGGATAAGACTCA
GGACTCTGGATTGGCTTCTTACGTCGCCGGCCAAATCGACAGGTCTCTGAGCTGGAAGGATGTGAAATGGCTGCAGACCATCACCAAGCTCCCAATCCTCGTCAAGGGAGTCATCACTGC
TGAAGATA
GTAAGCGCGTCCTTCATGTCCTGAGCACCAATTCACCATTTAGAAACCTGAACCTGATTCCAGATTGCCATTTGTTTGCAACTACTTCCTGCAACTAAAGTTTTGTGCATGA
AATTGATGCTGCAGCCCAGCTCGCCATTCAAAGCGGAGCCGCAGGTATTATAGTATCAAACCACGGCGCCCGACAGCTGGACTATGTCTCAGCAACCATCTCAGCTCTCGAGGAGGTTGT
GCTAGCCGCACGCGGCAGGGTACCAGTCTTCCTGGATGGAGGAGTCCGACGTGGAACCGACGTTCTCAAAGCCCTGGCTCTCGGAGCATCTGGTGTCTTT
GTGCGTAACCCAAAACACTA
CCCCCCCCCCCCTGTTCGAATCGGTTCCCTAGCTTACTGTGTCGCCACCTCGTGATGATCACTGATTTACCCGACCCATCGAACCTCGATGCATGACTGAAACGATGTGGTGTTTGCTCA
GGTTGGAAGACCCGTAGTGTTCGGCTTGGCAACGGACGGCCAGAAGGGGGTGGAGAAAGTGTTGCAGATGCTGAGGGACGAGTTTGAGCTGGCGATGGCGTTGGCCGGATGCACGAAAGT
GTCTGACATCAAACGCTCCCACATTCAAACCGAAGCGGAGCGACTGTACTCCAAGCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGACTGCCGAGGTTACCAATGTGACCGAGTATGAAGAACTCGCAAGGCAGAAGCTCCCGAAGATGGTGTTCGACTACTACGCTTCAGGTGCTGAGGACCAGTGGACCTTGAGAGAGA
ATCGCAACGCTTTCGAGCGTATCAG
ATTCCGGCCCCGCATCCTCATCGACGTTACGAAGGTGGATCTGACCACCAACGTATTGGGCTTCAACATCTCCATGCCCATCATGGTCGCTCCCA
CCGCCATGCAGAGGATGGCGCACCCGGACGGTGAATTGGCCACCGCCAGGGCTGTTTCAAAAGCTGGGACGATCATGACGCTGTCGTCGTGGGCGACCAGCAGCGTGGAGGAGGTCGCGT
CCGTAGGACCTGGCATCCGCTTCTTCCAGCTCTACGTGTACAAGGATAGGAACGTAGTCGCCCAGCTCGTACGCCGCGCTGAGAGAGCCGGCTTCAAGGCCATCGCCCTTACCGTCGACA
CCCCTCGCCTTGGACGCAGAGAGTCAGACATCAAGAACAGATTCGCTCTGCCAAGTCACCTCACTCTCGCCAACTTCGAGGGTCTGGATCTCGGAAAGATGGATAAGACTCAGGACTCTG
GATTGGCTTCTTACGTCGCCGGCCAAATCGACAGGTCTCTGAGCTGGAAGGATGTGAAATGGCTGCAGACCATCACCAAGCTCCCAATCCTCGTCAAGGGAGTCATCACTGCTGAAGATA
CCCAGCTCGCCATTCAAAGCGGAGCCGCAGGTATTATAGTATCAAACCACGGCGCCCGACAGCTGGACTATGTCTCAGCAACCATCTCAGCTCTCGAGGAGGTTGTGCTAGCCGCACGCG
GCAGGGTACCAGTCTTCCTGGATGGAGGAGTCCGACGTGGAACCGACGTTCTCAAAGCCCTGGCTCTCGGAGCATCTGGTGTCTTT
GTTGGAAGACCCGTAGTGTTCGGCTTGGCAACGG
ACGGCCAGAAGGGGGTGGAGAAAGTGTTGCAGATGCTGAGGGACGAGTTTGAGCTGGCGATGGCGTTGGCCGGATGCACGAAAGTGTCTGACATCAAACGCTCCCACATTCAAACCGAAG
CGGAGCGACTGTACTCCAAGCTGTAA

Retrieve as FASTA