Entry information : PpaMSD01 (Pp3c19_10240)
Entry ID 13914
Creation 2016-10-14 (Christophe Dunand)
Last sequence changes 2016-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: PpaMSD01 (Pp3c19_10240)
Name (synonym) PpaMSD01 (Pp3c19_10240)
Class Mn SOD    [Orthogroup: MSD001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaMSD01
start..stop
S start..stop
MpMSD01 324 5.47e-114 2..226 6..235
MpalMSD01 324 7.32e-114 15..226 14..228
HaMSD01 309 5.55e-108 14..226 6..223
ThasMSD01 308 8.98e-108 10..226 9..230
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '13914' 'complement(join(418679..418765,418936..419007,419240..419296,419808..419933,420274..420320,420474..420768))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 420474..420768 293 N° 2 420274..420320 45 N° 3 419808..419933 124 N° 4 419240..419296 55
N° 5 418936..419007 70 N° 6 418679..418765 85  
complement(join(418679..418765,418936..419007,419240..419296,419808..419933,4202 74..420320,420474..420768))


exon

Literature and cross-references PpaMSD01 (Pp3c19_10240)
Cluster/Prediction ref. Genebank:   5937492 [Incorrect prediction]
Protein sequence: PpaMSD01 (Pp3c19_10240)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   227
PWM (Da):   %s   25064.79  
PI (pH):   %s   9.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAALMQTGRRSLLTSTRLSAQRRAMATATLHTESLPDLDYDYGALEPAISGEIMKLHHQKHHQTYVTNFNKALEQMHSSNDPQTIVALQSAINFNGGGHVNHSIFWKNLAPISEGGGAP
PQGSLSKAIDAQFGDLDKLIAKMNAAGAGVQGSGWVWLGLNKDLKRLEVQTTMNQDALSSKGLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVVNWTDVAQRFEKA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAGCACTCATGCAAACTGGGCGCCGATCGTTGCTCACCTCCACCCGGTTATCGGCGCAGAGGAGAGCCATGGCAACTGCCACGCTGCACACTGAGAGCTTGCCGGATCTCGAC
TACGACTACGGGGCGCTGGAGCCAGCTATCAGCGGGGAGATCATGAAGCTTCACCACCAGAAGCACCACCAGACCTACGTTACCAATTTCAACAAGGCTTTGGAGCAGATGCACTCCTCC
AATGATCCACAGACCATTGTTGCCCTGCAGTCCGCTATCAATTTCAATGGCGGAG
GTACGTGGTTAGAACCTGGAGTTTAGGTTTGTGTATTTATTTTTTCCTTTTTTTTTTTTTTTTTT
TTTTTTTTTTTCTCTGATTTTGGAGGGGAATCGGCTTGCGTGGGTTTATGTTTCTTTTTTTGTTTTTTTGGGGGGGTTTGTGCTGCAGGGGGCATGTTAATCACTCAATCTTTTGGAAGA
ATCTTGCACCCATCAGT
GTAAGCTCGCGCACTTAGGTTTTAATCTGGGTGATGCATGTTGGGTTCAGAGGTCTTTTAGTTAGGAGAATATTGCCCTAATTGTTACCATGAAACCCTACAT
GCTCTGGGTTGTTTGTTATTGGGGAGGTTTATGCTTTGCGATTTGGTTATGCGGATGTCCAGTTAGACTCATCTGACAACTTTCTCATTCTGGAGTTTTGCGCACAGAACGTCTCTTTGG
AGATCACATGTCCTGGGCTGTGATAAGAACGATTCTAGTGAGGACATTTAGAACAGAATTCCCTGAATTCATTTCTGATCACAATTTTGCTCTTCTCAATATCAATGGCTTTTGCAGGAG
AAGGAGGAGGTGCACCCCCTCAGGGAAGCCTTTCTAAGGCCATTGATGCACAGTTTGGGGACCTGGACAAATTGATTGCAAAGATGAATGCTGCGGGCGCTGGTGTGCAGGGATCCGGCT
GGGTG
GTACGATCTATAATGACCTATTTACCTCGCAACATGCATATTCGAATATGCGACCTTCTTTCAGTCTATGTTAGCCCTCGTTTACAGTTATAAGACTCATCCGCACATACATAGA
TATTTGCCCCCCCATGCCGCTCCTATCCTTTGCACAACGCGTCTGACTTCTCCATGATTGTCCTCGATAGCAGGCGAGGAGGGTAGTGAGTGGATGCGTATGCGAGTTCTCATCTCTAGG
TGCTAGGGTCTCGGAATTTAATTTTTTGTGTAAGGTAGAGGTGTCTGTGAAAGGCAAACGAATTGGCATATTTTAGGGATCACCAGCGTTACTTCACGTGCCGACCACCAGTATCTAAAA
AATATTTGTAGCTAATTTAAACCAAATCTTCTCTTAATTAATTTTTGAGATTATGGTTTTCAGCTATTCTGCAATTGAACGACTTTTTCTTTCACTCAACTCAGTTCTAATAATTATCTG
GAGCTGGGTGTTATAATCTTGTATCTTTGTGAGCAGTGTGGCTGGGTTTGAACAAGGATTTGAAGAGACTTGAAGTGCAGACAACCATGAACCAGGTTTGTGAGGGTTTTAATGCTTAAT
TGGATGATCAAGTACGGATTCTAGCGTTGATTCATTTGATTTATTTCTTTTCTTGATATTCAGCATGCTGGGTTTTGCCAGAGCTTCAGATATATGGAAAAGTAGGAGGCTTGTAGACTC
ATTGTTCCTTGTTGAGATTCTTTTTAACTGGATCTGTTAGCTTCACATGATTGATGGATAACATGAACATCGTTTGGAACCGCTCAGGAGATGCCTTGTCGTCAAAGGGCCTCGTTCCCT
TACTTGGAATTGATGTCTGGGAACATGCCTACTACTTGCAG
GTAAAATCTTCTCCCTGTGTGATTGCACATCTTCAATGAATTTTAGCTCCATGCTTGCTGTCATCGTGTGAAATGTGGA
ATAACCATCTGCTCACATGTTGTATTTGGTTACTTCACAAGTGTTTCTAAGAAAGTTCTAAAATCTGGAATTTTTAATTGTTGGCAAGTAGTATACAAGAACGTGAGGCCCGACTATCTG
AAGAACATCTGGAAGGTTGTAAACTGGACGGATGTGGCTCAGCGCTTTGAGAAAGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCAGCACTCATGCAAACTGGGCGCCGATCGTTGCTCACCTCCACCCGGTTATCGGCGCAGAGGAGAGCCATGGCAACTGCCACGCTGCACACTGAGAGCTTGCCGGATCTCGAC
TACGACTACGGGGCGCTGGAGCCAGCTATCAGCGGGGAGATCATGAAGCTTCACCACCAGAAGCACCACCAGACCTACGTTACCAATTTCAACAAGGCTTTGGAGCAGATGCACTCCTCC
AATGATCCACAGACCATTGTTGCCCTGCAGTCCGCTATCAATTTCAATGGCGGAG
GGCATGTTAATCACTCAATCTTTTGGAAGAATCTTGCACCCATCAGTGAAGGAGGAGGTGCACCC
CCTCAGGGAAGCCTTTCTAAGGCCATTGATGCACAGTTTGGGGACCTGGACAAATTGATTGCAAAGATGAATGCTGCGGGCGCTGGTGTGCAGGGATCCGGCTGGGTG
TGGCTGGGTTTG
AACAAGGATTTGAAGAGACTTGAAGTGCAGACAACCATGAACCAG
GATGCCTTGTCGTCAAAGGGCCTCGTTCCCTTACTTGGAATTGATGTCTGGGAACATGCCTACTACTTGCAGTAC
AAGAACGTGAGGCCCGACTATCTGAAGAACATCTGGAAGGTTGTAAACTGGACGGATGTGGCTCAGCGCTTTGAGAAAGCCTGA

Retrieve as FASTA