Entry information : AtGrxC01 (At5g63030/GRXC1)
Entry ID 13951
Creation 2016-10-18 (Christophe Dunand)
Last sequence changes 2016-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: AtGrxC01 (At5g63030/GRXC1)
Name (synonym) AtGrxC01 (At5g63030/GRXC1)
Class CGYC Grx    [Orthogroup: GrxC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtGrxC01
start..stop
S start..stop
ThasGrxC01 210 3.07e-72 1..125 1..125
HaGrxC23 175 2.66e-58 1..125 1..127
HaGrxC25 149 3.41e-48 21..123 5..107
ThasGrxC02 143 7.14e-46 19..123 3..107
Gene structure Fichier Exons


exon

Literature and cross-references AtGrxC01 (At5g63030/GRXC1)
Cluster/Prediction ref. Genebank:   836423
Protein sequence: AtGrxC01 (At5g63030/GRXC1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   125
PWM (Da):   %s   13601.78  
PI (pH):   %s   5.16
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSMFSGNRMSKEEMEVVVNKAKEIVSAYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEMSDGGEIQSALSEWTGQTTVPNVFIKGNHIGGCDRVMETNKQGKLVPLLTEAGAIAD
NSSQL*

Retrieve as FASTA  
Remarks Compleet sequence from genomic (chromo 5, 3 introns)
DNA
Send to BLAST
CDS
Send to BLAST