Entry information : KflGrxC01 (Kfl_006860010)
Entry ID 13956
Creation 2016-10-19 (Christophe Dunand)
Last sequence changes 2016-10-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-10-20 (Christophe Dunand)
Peroxidase information: KflGrxC01 (Kfl_006860010)
Name (synonym) KflGrxC01 (Kfl_006860010)
Class CGYC Grx    [Orthogroup: GrxC001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflGrxC01
start..stop
S start..stop
HaGrxC25 139 1e-44 15..116 1..102
MpGrxC03 138 3e-44 15..116 1..102
ThasGrxC02 138 4e-44 15..116 1..102
PpaGrxC02 136 3e-43 15..116 1..102
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 234..331 98 N° 2 1184..1272 89 N° 3 2123..2221 99 N° 4 2694..2758 65
join(234..331,1184..1272,2123..2221,2694..2758)


exon

Literature and cross-references KflGrxC01 (Kfl_006860010)
DNA ref. GenBank:   DF237635.1 (234..2758)
Protein sequence: KflGrxC01 (Kfl_006860010)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   116
PWM (Da):   %s   12047.23  
PI (pH):   %s   9.68
Sequence 157
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGITASRSSGPRATMALSKAQAIVDANPVAIFSKTYCPYCTRVKKLFSQLGAKAKVVELDTEEDGDEIQNALAQMTGQRTVPNVFIGGKSIGGSDSTSALHSQGKLVPQLQAVKAL

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGGATTACAGCAAGCAGATCAAGCGGACCGCGCGCGACCATGGCACTCTCAAAAGCACAGGCGATTGTGGATGCAAACCCCGTCGCAATCTTCAGGTGAGGCGACGTTTGCACTTGAC
GCGCTTACAAAACATGAAACCGCAGTGGTTGGAAAGCTACCTGATGAGGAGGAGACGGATTTTTGTTAGGAAACATATTCTGCATCCTTTGAAGATCTAATGTGGGCCTTCCTTTCCCAG
CAGTTTGACGATTCGCTAGAAATTGTTGATGGTAGCAACCGGCCCTGGAACAACATGTGCGACGATTGTTCATGACCAGTAATTGAATGAGATCGTCTATTAGGCTTTTATAATGTAAGA
TCCTCTCATAGAGGCTGTAGCATCTTATCCTGGAAAGTTGCCACGTATGTTGCTTTTAATTTCCATCTCTGCCAAACATCTCGATGGTGTCTGCTGGAGCAGACTTAGATGTCAATACAA
ACAGATGGTTTCTTCATGGCAGTTGTCTTCTTTAGAGTCTCAGCTGGTGGAAGTCCGCCCATGTGTCTCTTTGTTTTGGTGCGGCACTAGAGTTCATATGCATTCAATCTTTCATATTAG
CAAGTTGTCATGGGAACCTGCTGGGTCTGTGTGTCAAAACCAGAGGTTTTTAACGGGTGGCACTGGCAACTCTGGTTCTTGTTGTGGCAATAGGTTGACTACTCGAATGCCAACACCAAG
GGGATATTTCAACTCTGTAGTGTTCGCAAGCATTCGACAATTCGTTAGAATAGTTTTGCCCAGAACAGAAGAAGCGCTAGCCCTTCACCTGCTTTTCTATATTACGGGCAAGATTATCAG
ACTCTTGTGGTGGCCAGCTTTTCGCAAAGCTTCTCAGTGATTTTTTGAATCAACTAGATGTTGAAAAAGCCCCTGTGTTTTTAACCTCTTTGAGCAAACCTCCTTGCAGCAAAACATACT
GCCCCTACTGCACGCGCGTGAAGAAGCTGTTCAGCCAATTGGGGGCCAAGGCGAAGGTCGTCGAACTCGACACAGAAG
GTGACTGCTCTTGCCATTCCCTTTGTTTCAGTATTAGGATGG
CAGTCCGAAGAGAGCTGAGGGGTGGCAGAACAGTAGTGTGTGTTCAAAAGCAGATTGACAATATCTGCTAGAACCATCAGCATTGTTGCAGGTTACAAGTCATCGTCTCGCTCAAATGCC
GACCACTCTACCGGCTTCTCGAATCCTCGGGGTGTAACGAACCCAAAATCTCGGATTGTAATAAACTCCTCTTAGGAAAGAGACGCTGCTGTCTCTGGCGCCTCAGAGGACGAACTTCTG
GTGTGGGGGCTTCTGCAAGGCCTCAGCATGTTCTGTGTGACGCGCCTCTGACGCGGTGTTTTGTCATAAGGAGCGCAAATCCTTGGTGCTTCTGTTCTGGACCCTCGTCTGCAATGTCTG
GGACAGACGGCACAGCTGACAGACTTTCTGTCACGATTTCATCATGAGCAAGTGTAGTGGAATCCTTTTAAAGTGGAAAGAAGGGCTGTGCCCTTTGCAGCCTACATGAGCGCGCATCCG
TTGAACGATCGTTTCAAACTTTTGGACTTGAATGGACTTTCGGACTCGAAGTGCCTTGCCACCCACTCGAAGGCAGTCCAGGGGACTGACGAGTACGACTAGGATTTTGTAAGTATGCAG
GGGATTCGACTCCGGATATTCCACACCAGATGTCGACCGCCCGTCTTCTGACTTAGCTTGTGCGGATGGGAACTGCATTCGACGCCCATAGTTTCATGGCGAACCACCTGGCAGTCCAAT
TTGCTTGCGCCTTTTGTCAGGCAAAGCCCATTTCAACAACGCTCGTAAAGCGAAGCTCCTGACGTTGCTTGAATTGCTCGTGCTTCAGAGGACGGCGATGAGATCCAAAACGCCCTGGCT
CAGATGACCGGACAGCGGACGGTACCAAATGTCTTCATCGGGGGAAAGAGCATTGGGGGCAGCGACA
GTGAGTTCTTCTACGATCTGCTTTTCCGCATCTCTTGCTCCGCTTGCACCGTT
CGTTAGTCTCTACTTCACTGTTGTGTCCTCGCTTCGAAACGTGTGTCGATCCTCTTCTTCCAACAAGTCGTGTATAGCTCAATCTAATTCCCGTGGTTCCGTTCTCGGTTCTCGCTGGCT
CCTCATGTTCCTCTTCGTTCTCCTCGGCTGGGCGGCATATGTCTCGAAGCCGATCAAATATATGCTGTTCCGTCCGTTTACTCGTTTCATTCTCTTGTCCTTCCAAGCCAAAAGCTGTGC
CGCATCTCTCCTGGATACTGGTGGTCTTTCTTTGTTAGGTTGTCGACGCTCCTTACTTGCTTCTATTCTCGATACGTTGGTTGGCGACAGGCTCTCGTTGGGCCATGCCAATGACTAAAG
GTCGTCAAATCCCGGTTTATCGTACTCTAGTCTGTGACTGATTTCTGTACTCTGCGCAGGCACTAGTGCTTTGCACAGCCAGGGGAAGCTGGTTCCTCAGCTGCAGGCTGTCAAGGCTCT
TTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGGATTACAGCAAGCAGATCAAGCGGACCGCGCGCGACCATGGCACTCTCAAAAGCACAGGCGATTGTGGATGCAAACCCCGTCGCAATCTTCAGCAAAACATACTGCCCCTACTGCA
CGCGCGTGAAGAAGCTGTTCAGCCAATTGGGGGCCAAGGCGAAGGTCGTCGAACTCGACACAGAAG
AGGACGGCGATGAGATCCAAAACGCCCTGGCTCAGATGACCGGACAGCGGACGG
TACCAAATGTCTTCATCGGGGGAAAGAGCATTGGGGGCAGCGACA
GCACTAGTGCTTTGCACAGCCAGGGGAAGCTGGTTCCTCAGCTGCAGGCTGTCAAGGCTCTTTGA

Retrieve as FASTA