1. Browse the Database
  2. View Redoxidase
Entry information : CbraTrxM02 (g78792/CHBRA95g00020)
Entry ID 14141
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-09 (Christophe Dunand)
Peroxidase information: CbraTrxM02 (g78792/CHBRA95g00020)
Name (synonym) CbraTrxM02 (g78792/CHBRA95g00020)
Class Thioredoxin Type M    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Charophyceae Characeae Chara
Organism Chara braunii    [TaxId: 69332 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CbraTrxM02
start..stop		 S start..stop
KflTDX02 49 0.000000191 49..137 415..502
ThasTrxM04-2 47 0.000000474 58..120 115..177
AtTrxM04 46 0.000000744 58..135 115..193
ThasTrxM03 45 0.00000114 57..119 103..165
Gene structure Fichier Exons►


exon

Literature and cross-references CbraTrxM02 (g78792/CHBRA95g00020)
Protein sequence: CbraTrxM02 (g78792/CHBRA95g00020)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18991.8 Transmb domain:   %s   i13-30o
PI (pH):   %s   9.95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSTWHAGIEYFSSAVHRPRTKISCPCREQTKGRRRLSSICESSLSLELAPSYISRAWAGYCTAVHPLIRKLKTDFVGKPVNFIWAKSDNNPMLKSYGGKSQPHFLLYRNGNLMETVVGA
NVPLLAKLIPKLCPETLAEDKPEDNPMIKKRKEDLEAAAKKPDSAGKDSAT*

Retrieve as FASTA  
Remarks
DNA ►
Send to BLAST
CDS►
Send to BLAST