Entry information : CbraTrx01 (g31404/CHBRA382g00280/HCF164)
Entry ID 14152
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-04 (Christophe Dunand)
Peroxidase information: CbraTrx01 (g31404/CHBRA382g00280/HCF164)
Name (synonym) CbraTrx01 (g31404/CHBRA382g00280/HCF164)
Class Other Thioredoxin    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Charophyceae Characeae Chara
Organism Chara braunii    [TaxId: 69332 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits No significant hits
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 994497..994657 161 N° 2 993668..994310 643  
complement(join(993668..994310,994497..994657))


exon

Literature and cross-references CbraTrx01 (g31404/CHBRA382g00280/HCF164)
Protein sequence: CbraTrx01 (g31404/CHBRA382g00280/HCF164)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   267
PWM (Da):   %s   29225.15  
PI (pH):   %s   4.68
Sequence 309
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDTRHEGNDGAASVRVRASENGSRGSGKMQLRRRTVEGEVRRMTGMRRRRETQAATEEGGASFAVGGGGGGIDCAMAAPWLLVVLSSAWFFLLVQGGGLNPAIEWNSPKDLTAEFLAHNTKPIMTIIHKRWCGACRHLKEELSKDEADDFVKLSEEWVMVDGGDDDEPKADEYAPDGGYIPRIIFSEANGKVRNDIVCQVGGNPSYKYFYHSLHQVTETMKYARNVLSPPQPSPTPLGDDGDDDEKTEEESAKDAPPGDDDSVKVEL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACACGCGCCACGAAGGTAACGACGGTGCAGCGAGCGTACGCGTGCGAGCGAGCGAAAACGGCAGTCGAGGCAGCGGGAAGATGCAACTTAGGAGACGGACGGTAGAGGGGGAAGTG
AGGAGGATGACGGGTATGCGACGACGGAGGGAGACGCAGGC
GTAAGCCCGAAGGCAGGCTGGCAGCGGAGGAGTACGAGTGGTAAGATTGTGCCGCGGGAAAACGTTTGCTTGCTTGCTT
GCATAAGCTGGCCCCAACGAGAAAGACCGCTCGAGAGGGCGCCCTTTGACGCACGCCTACGAGTGCGCGCGCGCGAAAGGAGAGGCTTTGCTTGTGCCGTCTTGCAGGGCAACTGAGGAA
GGAGGCGCGAGTTTTGCCGTTGGTGGCGGCGGCGGCGGCATTGACTGCGCCATGGCTGCTCCCTGGCTGTTGGTTGTGCTGTCTTCAGCGTGGTTTTTCCTGCTTGTGCAGGGAGGAGGT
CTGAACCCTGCGATCGAATGGAATAGCCCCAAGGATCTAACGGCGGAGTTTCTGGCGCACAACACTAAACCTATCATGACGATCATTCACAAGAGGTGGTGCGGAGCCTGCCGGCACCTG
AAAGAGGAATTATCCAAGGACGAGGCTGACGATTTTGTGAAGCTGAGCGAGGAGTGGGTTATGGTTGACGGCGGGGACGACGACGAGCCGAAGGCAGATGAATATGCCCCGGATGGTGGC
TACATTCCGCGCATTATTTTCTCGGAAGCTAATGGGAAAGTTCGCAATGACATCGTTTGTCAGGTGGGCGGCAATCCATCCTACAAGTACTTTTACCATAGTCTCCATCAGGTCACGGAA
ACGATGAAGTACGCGCGGAACGTGCTGTCGCCACCTCAGCCATCGCCAACGCCGCTGGGCGACGACGGAGACGACGATGAGAAGACGGAGGAAGAAAGTGCTAAAGATGCACCACCTGGT
GATGACGATTCTGTTAAAGTAGAGCTGTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACACGCGCCACGAAGGTAACGACGGTGCAGCGAGCGTACGCGTGCGAGCGAGCGAAAACGGCAGTCGAGGCAGCGGGAAGATGCAACTTAGGAGACGGACGGTAGAGGGGGAAGTG
AGGAGGATGACGGGTATGCGACGACGGAGGGAGACGCAGGC
GGCAACTGAGGAAGGAGGCGCGAGTTTTGCCGTTGGTGGCGGCGGCGGCGGCATTGACTGCGCCATGGCTGCTCCCTGG
CTGTTGGTTGTGCTGTCTTCAGCGTGGTTTTTCCTGCTTGTGCAGGGAGGAGGTCTGAACCCTGCGATCGAATGGAATAGCCCCAAGGATCTAACGGCGGAGTTTCTGGCGCACAACACT
AAACCTATCATGACGATCATTCACAAGAGGTGGTGCGGAGCCTGCCGGCACCTGAAAGAGGAATTATCCAAGGACGAGGCTGACGATTTTGTGAAGCTGAGCGAGGAGTGGGTTATGGTT
GACGGCGGGGACGACGACGAGCCGAAGGCAGATGAATATGCCCCGGATGGTGGCTACATTCCGCGCATTATTTTCTCGGAAGCTAATGGGAAAGTTCGCAATGACATCGTTTGTCAGGTG
GGCGGCAATCCATCCTACAAGTACTTTTACCATAGTCTCCATCAGGTCACGGAAACGATGAAGTACGCGCGGAACGTGCTGTCGCCACCTCAGCCATCGCCAACGCCGCTGGGCGACGAC
GGAGACGACGATGAGAAGACGGAGGAAGAAAGTGCTAAAGATGCACCACCTGGTGATGACGATTCTGTTAAAGTAGAGCTGTG

Retrieve as FASTA