Entry information : KflTrx05 (KFL_004460040/WCRKC)
Entry ID 14175
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-09 (Christophe Dunand)
Peroxidase information: KflTrx05 (KFL_004460040/WCRKC)
Name (synonym) KflTrx05 (KFL_004460040/WCRKC)
Class Other Thioredoxin    [Orthogroup: Trx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflTrx05
start..stop
S start..stop
PpaTrx06 147 2e-46 9..124 76..188
AtTrx08 143 2e-44 10..124 91..206
HaTrx01 142 4e-44 12..126 71..186
PpaTrx07 142 4e-44 12..124 77..186
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 29339..29469 131 N° 2 30034..30105 72 N° 3 30675..30741 67 N° 4 31211..31228 18
N° 5 31527..31646 120  
join(29339..29469,30034..30105,30675..30741,31211..31228,31527..31646)


exon

Literature and cross-references KflTrx05 (KFL_004460040/WCRKC)
Protein sequence: KflTrx05 (KFL_004460040/WCRKC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   135
PWM (Da):   %s   14959.58  
PI (pH):   %s   4.98
Sequence 176
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALFGLGSEAPPESIPLTPIKTEEDLDAALQTAEEEGHALLIDWMATWCRKCIYLLPKMEKLSAEFHDVRFYMVNVNEVPGALVKRGGIQKMPTIQLWKNKERVGEVIGGHKAWMVMDEIRDMIKTDGVQGAGSS

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTGTTTGGACTTGGGAGCGAGGCCCCACCTGAGAGCATCCCCCTGACGCCAATCAAGACAGAGGAGGACCTCGACGCTGCGCTGCAAACAGCGGAGGAGGAGGGACATGCGCTCC
TTATTGACTG
GTGAGTAGTGGTCGAGTTGACTGCTAGCACAAGTACTGGAACGTGTGACATTTTCTGGATAATCTGGAACATGGATAATCGTAGAACGACGAACAAAAATCCTGAATCGC
TGTCAATCGAGTGGGCAATTCTCAGAGTTCAAATCCTGAAGAAAGCTGGGCATCTGTTTTCAAATGATTAAGAAGGGTTTCCGTCTAGCTAGACCGCTTGAAGTGGCACTAGATAAGTTG
TTGCCGAGCGGGTATGCGTCTCAAGGAGGTCGGACAATCAGCACAAAGACAAGGACGGGAGCTTGTCACTTGGCTGCAGCCCAAAGACCAACACAAAATGCCCAACCATGACATAACATG
TGCCTGCTAGTTTGATTGTTTGTGGTCTTGTTGAGGACAATTTTCGAAGATGCAGAATATTGAGGGGCATGTGGAAACAAGCGGAGAGAAGGGAGTGCTTCCTGCTGCCTTTCTAAGTTT
CTTCAAGGGCTCCCTTTTCCCATACCTCTTAGTGTCAAAGTCCTGTCTTCGCCCTTTGACACCAGAGTACAATTACTCTCTTCACCTTTCGCAGGATGGCCACCTGGTGTAGAAAGTGTA
TATACCTCCTCCCAAAGATGGAGAAACTGTCCGCCGAGTTTCACGA
GTGAGTCCCCAAGAACTTCTCTTTGGTTCGAAATTTTCACACAGAGAGTAAAGTACGAGAAAGTAAATCACCTC
CCTCTGCTACATCATTCCGTACTGCTCGAGGCTACCATAGGGAGCTGACATAAGACGGACTGGTTGCTCTTGTCCGATAGAAGCCGGCTGAATCTCACTTTTCTGTGCGCAAGCAGCTAT
CTCTAAACTTGTTTGCAACAGAGACCTACCCAGAACAACTTCCGAAGGTCACCTGATGTTCTGAAAGGCCACAAATCAAGCTGAATCTAACCTTCTCTTCTCGAGAAGTTTTACTCGAAC
TGCTGTCCTTATGTGGCTGGGACCAATGAGCCGGTGCGCTCGATCGTGAATGAGAGTCCAGTTTTCAAGTCAGCATAGCACCATGTTGCATTAACGTGCCATATGTGACCGTGCCTTTCA
ACCGTTTGGTCCAGCAACATCTTGCGCTTCACTGGAGGTGCAACGGATTTGTTGGAAGTTTTCGAATCTTCCTAAGAACGGGCCATTCCAACCCAGGTTCCCTACGAGTGAACACCGTCG
CTTTGTGTAATGCAGTGTCAGGTTCTACATGGTCAACGTCAACGAAGTGCCTGGAGCGCTCGTCAAGCGGGGCGGCATCCAAGTAAGTTGCAGTTCATTCCACCATCTTGAACGGCTGTA
ACGCACTTCTGTGTATCCACTCAGAAGAATTTTCCAACCGTTTCGTTACTTGGTGCTGCACCCATCCACCAGTCCATCTCGATACTGACAGGACGGCATATGAAACCACATGTGCTCGTT
TTTTGCAGCGATTTGCACCTTATTGACTTGCGTATGCAGAAAGTGTAAAACTTAATGTCAGTTCTTGAGAGCCTCGCATCTTGCAAGTAGTCAACATCCTAGTAGATTCCGGAACAACCC
CTGTTGGATCAAACTGCCTCAGTTACAATAATTGCTGGTGGATCAGAAGGCATCTGCGTAGAAGCTGATAATCTGAGCAGTTGCTGTTAACCGGGTGCTTGCTCGCGGTCTGTCTGCGTG
CACAATTCTACGAATGTCTTGCCCCTTCGGATGCTGATTGGCTTTGCTGTCCTCCTTGTCCGCTTGTGCAGAAGATGCCGACCATTCAGGTAAGAGTTCATTCAAGTCTTTGCGACTTCC
CGTCGACAGTAGCTTTCGTGACCTTTTCCGTAACTAATGAGGGGCAATGTACACAGTCAGAACCCTGAGTCCTTCGGGTATTCGGTCTCAAATGTATCGTGTTTGTGTTGTCTAACTCGA
CTTGAAAGTCAAGTTGCTCTGTATACGTCCCCCCATAATATTGCAGTCTAGTCGTGGATTGCGCAGCCTTTTCTCATCGGAAATTGACGCATTTAGAGACAGTGATTCGTTTCAAGAAGC
TTACGTGAAGCCGTTATGCTGCTGCAGCTTTGGAAGAACAAAGAGAGGGTAGGGGAAGTTATCGGGGGCCATAAGGCCTGGATGGTCATGGACGAGATCCGGGATATGATCAAGACGGAT
GGGGTTCAAGGGGCTGGTTCGAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTGTTTGGACTTGGGAGCGAGGCCCCACCTGAGAGCATCCCCCTGACGCCAATCAAGACAGAGGAGGACCTCGACGCTGCGCTGCAAACAGCGGAGGAGGAGGGACATGCGCTCC
TTATTGACTG
GATGGCCACCTGGTGTAGAAAGTGTATATACCTCCTCCCAAAGATGGAGAAACTGTCCGCCGAGTTTCACGATGTCAGGTTCTACATGGTCAACGTCAACGAAGTGCCTG
GAGCGCTCGTCAAGCGGGGCGGCATCCAA
AAGATGCCGACCATTCAGCTTTGGAAGAACAAAGAGAGGGTAGGGGAAGTTATCGGGGGCCATAAGGCCTGGATGGTCATGGACGAGATCC
GGGATATGATCAAGACGGATGGGGTTCAAGGGGCTGGTTCGAGTTGA

Retrieve as FASTA