Entry information : KflTrx04 (Kfl_001600130/F)
Entry ID 14176
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-09 (Christophe Dunand)
Peroxidase information: KflTrx04 (Kfl_001600130/F)
Name (synonym) KflTrx04 (Kfl_001600130/F)
Class Other Thioredoxin    [Orthogroup: Trx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflTrx04
start..stop
S start..stop
PpaTrx05 164 2.84e-51 19..206 2..190
CbraTrx07 147 7.17e-46 95..206 16..127
ThasTrx04 124 3.91e-36 1..206 1..184
HaTrx04 123 7.05e-36 95..206 64..175
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14176' 'join(78436..78735,79164..79224,79536..79597,79815..79853,80313..80354,80636..80752)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 78436..78735 298 N° 2 79164..79224 59 N° 3 79536..79597 60 N° 4 79815..79853 37
N° 5 80313..80354 40 N° 6 80636..80752 115  
join(78436..78735,79164..79224,79536..79597,79815..79853,80313..80354,80636..807 52)


exon

Literature and cross-references KflTrx04 (Kfl_001600130/F)
Protein sequence: KflTrx04 (Kfl_001600130/F)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   206 (316)
PWM (Da):   %s   22140.68 (33782.0)  
PI (pH):   %s   9.63 (7.31) Peptide Signal:   %s   cut: 29 range:23-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAITASHATVRLPSSFSCSSSLQDAAPTSSFALQHTSRITSASKP
RGLLSIASAPIHAGLFAKTAYLGRQLAVVRATQLRVSGGHRGRGGALVTRNAGTV
EKVTAKELDDILLNERTKPIVIDFYATWCGPCIMLAQELKLSAELGDKVRFLKVDTDEETMLASQLRIQGLPTMVFVSDDKTKNAIRTEGLLSSEQIKEIIEKEL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCACAGCATCACACGCAACGGTCCGGTTGCCGTCGTCGTTCAGCTGTAGCTCATCTTTGCAGGATGCGGCTCCCACTTCGTCCTTTGCACTTCAACACACCAGCAGAATCACT
TCAGCGTCCAAGCCTCGTGGGTTATTATCAATTGCTAGTGCACCGATTCATGCAGGCTTGTTTGCAAAGACTGCATATCTTGGCCGTCAACTAGCCGTAGTTCGCGCCACACAATTGCGT
GTATCAGGTGGTCACAGAGGGCGAGGTGGAGCTTTGGTGACGCGTAATGCTGGAACGGTG
TGGTGAGTCTTACAGCTTGAGAAGCTTTTCTTTTTGAAACGCCCCTTGCTCATTGTCTAA
AATTCAAAGGAGGATACTTGCGATAGGATAGAGCAGAGTTTCGCTAGACTAGTTTGGCCTCCCCCTGGAAGGGAATCGCTCCCCACCAAATTCTTTACTTGACATTCTGAGCAGAGCAAT
TCAGCAGAGTTGGCCTCTTCTCATATCTGAGAAGTCGGATCCCCTTCAGGACAGTGGTTTGTCAAAATGTTCCCGGATCAGTTCAAAGCTCACCGTCAATTCTGCTTCAGACCTTCCTGC
CATGGCTGCGGCTCTTGCCCTCCGGTATGAACTGAGAGTCACTTAATGTTCAATTTTTTGTCCTAGCTCCTTGCCAACTTCATATACAAAGTTCCCCAATGATCAGGCCAGTAAGTATTG
ACATGTGCAGGAAAAAGTGACCGCAAAGGAACTGGATGACATTCTGTTGAATGAAAGGACAAAACCAATCGCGGTGAGTGAGTTCTGCTACCATTGCTCTTCTTAATCATAGTCCAACTT
CGAAAGTCTCGTCATATATCAAGGAGAGGTCGCAAACACACGATATTCAGCTATTTAGTGGCCAGAATTGCGGACGCGCTTCTACTTCAAGTTTTCCACATGCCACCATGCTAGCCCCTC
TTATGGGAGGTCATCAGTGAGTAATAGTGGTAGTCATGCGATAGTCATGCAATGGGCTCGATTCGAATGAGTCATACTTCCAGGAGATGATGCGGCGCTTAAACAAAATTGGAGTCAAGA
GAATGAATGTCCTTTGATGTGCAGTGATTGACTTTTACGCAACGTGGTGTGGACCTTGCATCATGCTGGCACAGGAACTGAAACAGAGGTCAGCTTCTTCTCTTTGTTGCCAGACATGAA
TGCAGTATCTTCTGTCCTCTTCTGTAGACTGTAACAAGTGGGGGATCTTTCTTAGTCCCTGGCTCCCTCGATTGAGTGAGGCAAGCTGGCAGCTCTCGCGGTTCTATTCTTGTGCCTCTC
TTTTTTTTGATTGTCGGGTATGTATGGCATGCCTCTCGGATTGACGACTTTATTGCTCTTTGCAGCTCTCAGCAGAATTGGGGGACAAAGTGAGGTTCTTGAAGAGGTAGGTTGATCACG
AGATGTTGATTACGCCCAAGCTTTAAGACCACCCAAGTTCACGCACTCGGAGGACAGTTCCAATCTGACTACTGGGCTTGTTTATGGCACTCCAGGCATGCATCTCATCTGTGTTCTGAG
TTTCCTAGTCACTGTCGTCACTGTAACGACCATGCGTGTTTGGGCTTTGCTCTGCTAAAAAGTGTTGCTTGTCAAAGTTGGCTTTGGACGAAATTCTGATTGCTGTACGGACGAAAGGGC
TCTCGAAGTTCAGTTCAAAATTTGAGCATCTACCAGATCACTTGAAACTGCGTACTAGGAAGGGACTTACACGTCAAGCTGTGTCTCTCTGCTCCTCGAGCCTGGACTGAGGCCCACCTC
ATGCTCTGAAGACAAAATCCATCCCCTGGCGGAATAGTTGATAATAGTAGGCAAAGCTGCAAAAGTGATATGTCTCCTATTGCAGGTCGATACCGACGAAGAGACGATGCTTGCAAGCCA
ACTACGA
GAGTAAGATCTCTTACCTGCGCCTTACAGAATTCTGAATTGTCTGCCGGTTGGTTGGGTTTGTCTTGTCGAACGGACTGATGGCAAATCGAAGATGCAGCTTCTAAGCAAAAA
TGACGAGTGTGACGACGAGCCCGTCAAAGGCATAATAGACATCAGGCGACGAGGACTCTCGAAATCGTACCTTGTCGTAATCATCTCGTCTGATTGCTTGTTTTGTGCTTGTCTAGTTTG
CGGCATTCGTCATATGGTCGACTTAACACTATCGTATGGCTCTCATGCAGATCCAAGGACTGCCAACCATGGTCTTCGTCAGTGACGACAAAACGAAGAACGCTATCCGAACAGAAGGGT
TGTTGTCTTCTGAACAGATCAAGGAAATTATAGAGAAGGAACTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCACAGCATCACACGCAACGGTCCGGTTGCCGTCGTCGTTCAGCTGTAGCTCATCTTTGCAGGATGCGGCTCCCACTTCGTCCTTTGCACTTCAACACACCAGCAGAATCACT
TCAGCGTCCAAGCCTCGTGGGTTATTATCAATTGCTAGTGCACCGATTCATGCAGGCTTGTTTGCAAAGACTGCATATCTTGGCCGTCAACTAGCCGTAGTTCGCGCCACACAATTGCGT
GTATCAGGTGGTCACAGAGGGCGAGGTGGAGCTTTGGTGACGCGTAATGCTGGAACGGTG
GAAAAAGTGACCGCAAAGGAACTGGATGACATTCTGTTGAATGAAAGGACAAAACCAATC
G
TGATTGACTTTTACGCAACGTGGTGTGGACCTTGCATCATGCTGGCACAGGAACTGAAACAGCTCTCAGCAGAATTGGGGGACAAAGTGAGGTTCTTGAAGGTCGATACCGACGAAGAG
ACGATGCTTGCAAGCCAACTACGA
ATCCAAGGACTGCCAACCATGGTCTTCGTCAGTGACGACAAAACGAAGAACGCTATCCGAACAGAAGGGTTGTTGTCTTCTGAACAGATCAAGGAA
ATTATAGAGAAGGAACTCTAA

Retrieve as FASTA