Entry information : KflTrxH03 (Kfl_001920150)
Entry ID 14177
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-09 (Christophe Dunand)
Peroxidase information: KflTrxH03 (Kfl_001920150)
Name (synonym) KflTrxH03 (Kfl_001920150)
Class Thioredoxin Type H    [Orthogroup: TrxH002]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflTrxH03
start..stop
S start..stop
KflTrxH02 124 2e-38 4..110 7..113
PpaTrxH09 109 1e-32 4..105 2..105
PpaTrxH03 109 3e-32 1..110 30..145
KflTrxH01 108 6e-32 3..107 49..153
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 72425..72514 90 N° 2 72971..73087 117 N° 3 73623..73751 129  
join(72425..72514,72971..73087,73623..73751)


exon

Literature and cross-references KflTrxH03 (Kfl_001920150)
Protein sequence: KflTrxH03 (Kfl_001920150)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   111
PWM (Da):   %s   12381.22  
PI (pH):   %s   5.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEDHGPVIIVTSKAHWDQLHQENAGSTVVVDFWATWCGPCKHIAPVFVELAKQYPHVVFLKVDVDENQDIAQMEDISAMPTFRVYKRGNKIDELIGASKEKLEQLVATNS*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGGATCACGGGCCTGTCATCATTGTGACCAGCAAAGCGCACTGGGACCAATTGCATCAGGAGAATGCGGGGTCCACTGTTGTGGTGAGTTGCGTACACCTTTGTGCGCTGTTT
GTTGCTTCTGGTCATTGTTTTTTTGTGTCCATGCAGATTGCATGATAGAGATGCATCCCAATCGAGCAATCGATGAGTTGCTTCTGCAGTATGGATTTATCGCAAACATCCAGGATACTA
AGTCTATGCTGTCTACTTTAGACACGCTCTACTAGTGCTTGTGTTCGGCCGCTTCTGCCAGCAGCTTATTTGAGTAGTTTGGCCTGCCATATTGTTACTCTGACATATTCAGTATCGAGT
GCGGTGTGAAATCGTTGCAAAGTCAGTGCTCACTTTGAGGGTCTCGATTTAGATTTGTTGAATCCTTTCTATCAGAGGTATTGATCCAACAGAACGCTTTCAGCAAACCGACATGAGTAG
GTTTCCAGTAGATATGACAATATTAGGATGCAGTACAGACAATTCCATCTCCAACTGTCTCTTCAGGTCGATTTTTGGGCCACATGGTGCGGGCCATGCAAGCACATTGCTCCCGTCTTC
GTTGAATTGGCAAAGCAATACCCGCATGTGGTGTTCCTCAAGGTGGACGTGGACGAGAACCAA
GTAAGTTCTCAGCTCAAGCTATCGTTGTCCTTGCGTCTGTCTTTCCAGCTTTCCTGC
CTCCATTTGATCTGGTTTATGTTTCTGCAGCTTATTACTTGAATTTATGGATCTGTGCTGCCGGTATAGGAGCTTACAGCCTTCTTTGTGGCGGAGGCAGCATTTTGGCTGGTACTGGCA
GGCATAGTATACACCTGGGCCTCATACATAGTTCAGCCAATCTGCCATTGGGAATGTCCTGAGTCGCAGCTTTTAGGGTTTGTCCATTCGGATCCATTCAAAATATATGTTGGCTGCCTA
AGGTATCCCTGATGAGCAATCAGCATTTCAGCTAATGACAGCCAACGACTGTCACGAGTTTGGTCTGGAGCTTGAGGAGCTCACAGGAGGATTGTAAAACCGAGCACTTGCAAATCGCCC
GCCAACTACAGTTTGAAGTGATTTTAGGTTTGGGTGAATGCATACACGGGCTACTTCTGTTGCTTGATCGTGGTAGTGGAGCACATGTATTCAAAGCCCCAGTCTGTTTGTTGCGCAGGA
CATTGCTCAGATGGAGGATATCAGTGCCATGCCAACTTTCCGTGTCTACAAACGCGGCAATAAGATCGACGAGCTGATTGGGGCAAGCAAAGAGAAATTGGAGCAACTGGTAGCCACGAA
CTCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGAGGATCACGGGCCTGTCATCATTGTGACCAGCAAAGCGCACTGGGACCAATTGCATCAGGAGAATGCGGGGTCCACTGTTGTGGTCGATTTTTGGGCCACATGGTGCGGGCCA
TGCAAGCACATTGCTCCCGTCTTCGTTGAATTGGCAAAGCAATACCCGCATGTGGTGTTCCTCAAGGTGGACGTGGACGAGAACCAA
GACATTGCTCAGATGGAGGATATCAGTGCCATG
CCAACTTTCCGTGTCTACAAACGCGGCAATAAGATCGACGAGCTGATTGGGGCAAGCAAAGAGAAATTGGAGCAACTGGTAGCCACGAACTCCTAG

Retrieve as FASTA