Entry information : KflTrxH02 (KFL_005730030)
Entry ID 14179
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-09 (Christophe Dunand)
Peroxidase information: KflTrxH02 (KFL_005730030)
Name (synonym) KflTrxH02 (KFL_005730030)
Class Thioredoxin Type H    [Orthogroup: TrxH002]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflTrxH02
start..stop
S start..stop
KflTrxH03 124 2e-38 7..113 4..110
KflTrxH01 96 1e-26 14..110 57..153
PpaTrxH09 92 1e-25 14..107 9..104
CbraTDX01 94 1e-25 21..110 88..177
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16510..16602 93 N° 2 17590..17712 123 N° 3 18737..18880 144  
join(16510..16602,17590..17712,18737..18880)


exon

Literature and cross-references KflTrxH02 (KFL_005730030)
Protein sequence: KflTrxH02 (KFL_005730030)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   119
PWM (Da):   %s   13332.7  
PI (pH):   %s   5.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASPADDLPVIHVKSKAEWDKFRFESGSELFFVDFWATWCSPCRVMSPVFVQLANQHPKIKFLKVDIDELQDVALQENIMSVPTFRAYQGGRAVDEFVGANKQHLEAFVVAHVQTVTA*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGCCAGTCCTGCTGATGATCTCCCCGTCATCCACGTAAAGTCCAAGGCCGAGTGGGACAAGTTCCGCTTTGAGAGCGGTTCTGAGCTGGTGAGACTTTTCATGACATTATGCTGA
GATTGTTCACACCACCATGATGAGACTTTGGATTGATGTTTGTGTGATCTTCTTGCCACCCTCTTGAGATGCCCCTTTACTGTCATGGTTTTTTCTGTGGATATCAGTGCTTTGACATAT
ATACAAGAAGAGAGATCAACATCCACGTTCAGACAGAACCTGTCCTGAACCATCTTCCTTGCCACATGTTAGCCACATCCTGCAAGCCTTTTTCACTCTGAACAGCTTAATCTGCCTCGT
CCACATTGATGCCGCGGCATCTGTTGTTCACCGCGCCGTCTTTAATAGCTCCAAAACATAATAAGTCACTGTAGGAAGCCTGATTGGAAGTAAGGTAAACGGGTTTGAATACAAAGACGA
AATGCGGAGGACAAAGTACAAAGGAGTTTCTATAGTGCTGTCCGCAGTGGTTCCTTGTGACTTGATAAGATGGGGCGACAGCTCTTTAGGAAAACGCCAGGGCTTCCCAGTTTTACATGT
CAAGTTTTCTTCTTCCTTTCCACCTTCTTTGCTTTATTCGTTGGGTATGATTTCCATGGGGGCCAATCTCTGGTTTCTGCACGTCCTCCTGGGAAGCTTGACATACAATGGAGGACCTGA
TCCAACCAGGCAATGGTGGCTCAACGGCGAGGAGTTGGAATATTAACGAGTGTCAGTGTGTGAAGTTGGAAAGAGTCTGCTAAACAGTGTTTCTTGATGACAAACCCAATCTTGTGCTCA
AGTAGTCTTTCCGTGTCACCCTCCCTGCTTCTTGTCAGCTGCTTAGCATCATCTATGACTTCTACAACCAGGTCTCTGAATTCTCAGCCAGGCTTTCTCAACCTTCATCATAATCCATAC
AGCTTCCGAAAAGGTGAACTCTGCGCCCCAAAACGCACAAGGAAGGAAAGCGAGAGAAACCGATTATGCGAAAGGCGCTTGGAAGGGACGGTTAAAGCTGAGCTCTCGGATTGTCCGCAG

TTCTTCGTCGACTTTTGGGCGACTTGGTGCAGCCCCTGCCGGGTGATGTCCCCAGTGTTTGTACAGCTGGCGAATCAGCACCCGAAAATCAAGTTCCTCAAAGTGGACATTGACGAATTG
CAG
GTGAGAGGTGCACCGCCGCTCTGGCGACCCGTCCCCTTCTTTCGTGTGCCTTCCTCATTCATTTGATTGTTAAGTTTCTTTGACAGGGAACCCCGCTTTGTATATCCTGTTCTAGAG
AACTTTGAAATCTGCTCTTCTCTGCATTGAGCGAGCTCTACCGCCCCGCCTACTTTAACGGCACAGAAGTTCCGGTTACTCGCATGTCCGAAATGGATATGCACTGCTAATATCCGTCGA
GTCTGCTTGGCCGCCTTCTTCCACATCGCGGGGCGGCCTGATTGGGTTACAGTTGCTAGCATTTACAGGATGCTCTACACTCTATCATTAAAAGCTATATACAAAAGCACGAAGAAACGT
CCCAGGAAGCTTTTATTGCTTATTTGGGGATTCCGCACCTCTGTTTGCACCCGGGTTGGATCAGCGACCTTCGTCTGCTTTACAGCCAAAGTTGATTGGTCGGACTCTATCCGACATGTT
TAGTGGTGTGCGCTCGACGAGCCACTTGCTTCTCGGAGCGTTTTTGAAACGCTGCAGCTTCAACAAGAAAGTCGAATAGTATAGGAATTACTGTTAATGAAACACGTAGAGCGCGAGAGA
GGTGAGTCCGGCAGGATGAACTCGACAGCACGGAACAATTTATGTAGCTGTCGAGTCTTGACTGGACCGTTGACGTTAACAGCCTTGATGCTTTCCGGTCATCAGGTCCCTCAAGTGTGT
AGAAAGCCCGGTCATTGAACAGGATATGCCTGATGGTTCTCGATAACAGGACCTCTTCCGGCCCTAGCGCACCCAATCATCCAACGGGGTTTGTATGATGGCTTTCGAGCTCTAGAGTGC
ATGATTGCCCGGTCTCTGGGAAAAGGGTTTGGATATTGGATTCTTGGAACAGGGTCTCTCACGGGCAAAAAGCGCCAGTCCTTTTACGGAAATTGCCGTGTGGTTTCTCGACTTAGTAGC
GAGAAAACAACATTGTCTCACTCCGGACAATGAAAGTCGGTCTCTGAACAGGTTTTCTCCTCCGCAGGATGTCGCGTTGCAAGAAAACATCATGTCCGTGCCCACGTTCCGTGCTTACCA
AGGCGGGAGAGCCGTCGACGAGTTCGTGGGGGCGAACAAGCAGCACCTGGAGGCCTTCGTAGTGGCACACGTACAGACGGTGACTGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGCCAGTCCTGCTGATGATCTCCCCGTCATCCACGTAAAGTCCAAGGCCGAGTGGGACAAGTTCCGCTTTGAGAGCGGTTCTGAGCTGTTCTTCGTCGACTTTTGGGCGACTTGG
TGCAGCCCCTGCCGGGTGATGTCCCCAGTGTTTGTACAGCTGGCGAATCAGCACCCGAAAATCAAGTTCCTCAAAGTGGACATTGACGAATTGCAG
GATGTCGCGTTGCAAGAAAACATC
ATGTCCGTGCCCACGTTCCGTGCTTACCAAGGCGGGAGAGCCGTCGACGAGTTCGTGGGGGCGAACAAGCAGCACCTGGAGGCCTTCGTAGTGGCACACGTACAGACGGTGACTGCGTGA

Retrieve as FASTA