Entry information : KflAPR01 (Kfl_000020020)
Entry ID 14186
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-09 (Christophe Dunand)
Peroxidase information: KflAPR01 (Kfl_000020020)
Name (synonym) KflAPR01 (Kfl_000020020)
Class Thioredoxin Type APR    [Orthogroup: APR001]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflAPR01
start..stop
S start..stop
HaAPR02 514 0 93..508 83..460
ThasAPR02 513 3.2e-180 82..508 75..464
ThasAPR01 511 2.32e-179 26..508 5..457
AtAPR03 508 2.01e-178 93..508 81..457
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '14186' 'join(7583..7715,7866..7982,8175..8310,8553..8667,8854..8985,9179..9418,9679..9795,10355..10648,10942..10998,11142..11360)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7583..7715 131 N° 2 7866..7982 115 N° 3 8175..8310 134 N° 4 8553..8667 113
N° 5 8854..8985 130 N° 6 9179..9418 238 N° 7 9679..9795 115 N° 8 10355..10648 292
N° 9 10942..10998 55 N° 10 11142..11360 217  
join(7583..7715,7866..7982,8175..8310,8553..8667,8854..8985,9179..9418,9679..979 5,10355..10648,10942..10998,11142..11360)


exon

Literature and cross-references KflAPR01 (Kfl_000020020)
Protein sequence: KflAPR01 (Kfl_000020020)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   519
PWM (Da):   %s   55315.95  
PI (pH):   %s   6.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALSTLAPQLGSASWAATTGHRPHGASSREACVAGTRLALHGAPEAPTAAAAVSAFWGHQLRRLPGAAIRSQRTACSRIRAVSVVEAPPSAGEVVDYAALAKDLAASSPLEIMDTALDLF
GKNIGIAF
SGAEDVALIEYARLTGRPFRVFSLDTGRLNAETYRYFAVEAHYGIRIEYCFPEAKEVEDLVRTKGMFSFYEDGHQECCAVRKVRPLRKQLRTLDAWITGQRKDQSPGTRAAV
PVVQVDPAFEGLSGGPGSLVKFNPLANVKGTDVWGFLRLLNVPVNELHSK
GFVSIGCEPCTRSVLPGQHEREGRWWWEDATMKECGLHKGNIAVAAPQSAAPLTTGNGAAAANGAAPGAE
VAAGTEGDASTEASTAVTSAPSEHADLYADTDAVASLSKEDVEQLLRSTGQDATLLVLYAPWCRFCQ
AMEESYVQLGEQLRGTNVRVASFRADGPERAFAQKEFGLKSFPTIVLFPRRAQ
GSRSRAFVTYPSERRDPASLLAFVSAIAGPVGETWSGP*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCTGAGCACCCTTGCCCCTCAACTGGGGAGTGCGTCGTGGGCGGCGACCACTGGTCATCGTCCACACGGGGCCAGTTCAAGGGAGGCGTGTGTTGCAGGGACTCGTCTGGCCCTA
CACGGAGCACCAG
AGGTAAGTGGACGACCGCCGTTTTCCTGTGAGGCAGTGGTGGGTGAGCCTTGAGCTGCTGGATCATGCTGTCGCCACGCTGTGTGCTGGCCAGTCCCGACCTGCCTG
CCCGCTGTGGCTCATCTGTCAGCCTGCCTGCCTCGCTCACTGCAGAGGCCCCCACCGCTGCTGCTGCGGTCTCTGCCTTCTGGGGGCACCAGCTGCGGCGGCTGCCTGGCGCGGCTATCC
GCAGCCAGCGGACAGCATGCTCAAGGATCAGAGCGGTCTCAG
AGGTGCGCACTGGCCTGGACTGACGAGCCTCCACCTTAGTGCGATGCTTACCCTTCGGTCATCCTAGCGACCTGGCGC
CACCTCGCCTCTTGCCTGCCGCTGCCTCTGAAGCTCGTATTTTGGTCTGACTTCCGATGAGGCCTGCGCCGTGGTCCGCTGTTCCCCACCTCGTTGATTGTGGCAACGGTGTGCAGTGGT
GGAGGCTCCCCCGTCCGCAGGGGAGGTGGTGGACTACGCTGCTCTGGCCAAGGATCTGGCGGCGTCGTCCCCGCTGGAGATCATGGACACTGCGCTGGACCTGTTTGGCAAAAACATTGG
CATTGCCTTCAG
AGGTGGGCCTAACTTACACGCACCTCAGATTTACACGGACGTTCTGCCGCTGCTTGTGGCTGCCTGCTTTGAGGCAGCATTGCCGACTGGAACCTGGGAGGCGTGTCC
GCTAGCTGCGTGTCCGGTCCTCGCTGCTTGCCCTTCTGCAACTGGGCCCGCAAGCGGCCCTGCGCCTGTACTGTACACCACATGTCCGCCTCTGCCAGGCCGCTTCCTGCGCATTTACTG
CTGGGTCTGATTGCAGTGGGGCTGAGGATGTGGCCCTCATTGAGTACGCGCGGCTCACGGGACGGCCCTTTCGGGTGTTCAGCCTGGATACCGGCCGCTTGAACGCAGAGACGTACCGCT
ACTTTGCTCAG
AGGTGGGCAGCGCTGGCCAGCCGCTGCAAGTGCTGGGTGCTGCATCAGGAGCGTGCTTAGGGCCCCCATGCGCATGTTTCTGCACCAGATCTGTCTGGCACCCCTCTCT
CCGCTGCTCGTGTCCAGCCCCTGGTGCTCTGTGCGTCGCTGCCCGCCCTGCTGAGTCGTGCTGGCGGTGCGGCGCTCAGGTGGAGGCGCACTACGGCATCCGCATCGAGTACTGCTTCCC
GGAGGCCAAGGAGGTGGAGGACCTGGTGCGCACCAAGGGCATGTTCAGCTTCTACGAAGACGGCCACCAGGAGTGCTGCGCCGTCCGCAAG
AGGTAACGCCCCGCGGCAGGCACCCCCCC
GCCCCTCCGACGGAAGCTGCTCCAAGCAGGTGCCTCTCCGCCGGCGCTTGAGCCCAGCTTTGTCACATGTGCTGCTGGTGTGTGTATTGCCAGCTCCTCTGTGCTCAGGCGGGCAGCCAC
CCTGCGTGGGTCCCGTCGTGAGCAAGTCCCCGGTGCGCGCGTGCAGGTGCGGCCGCTGCGTAAGCAGCTGCGGACGCTGGACGCGTGGATCACGGGGCAGCGCAAGGACCAGAGCCCCGG
GACGCGAGCCGCTGTGCCGGTGGTGCAGGTGGACCCCGCGTTTGAGGGCCTCTCTGGGGGGCCCGGCAGCCTGGTCAAGTTCAACCCGCTGGCCAACGTCAAGGGCACCGATGTGTGGGG
CTTCCTGCGCCTGCTCAATGTGCCCGTCAACGAGCTGCACTCCAAG
AGGTGGGGGGCCCCAGCAGTAGCACAAAGGCCGGGCATGGCAGCTTTGTTGCGGCACTGATGGGCCCCACTGAG
CGTACAGTGCCCGCCGCCCGCTTGTCAGTGCAAAGCCAGCCTAGGTACGCCGACTGCAGCGGTTGCCTTACCTGCGGTCCCTTTCTCTTGTTTCACGTGCATCTTCATGTTTTGGGGGTG
ATGATCCTCATGTCGCTCTTCATACAAACCTGGCGTTGCCGGTTGGCTGATGCGGTTCGTGCGTGCAGGGCTTTGTGTCCATTGGGTGTGAGCCGTGCACGCGGTCGGTGCTCCCTGGGC
AGCATGAGCGGGAGGGCCGCTGGTGGTGGGAGGATGCCACCATGAAGGAGTGCGGCCTGCACAAA
AAGTGAGCCCCCACACCGGCGCCTCTCCGGCACCTGCCGCAGCCCGCGCTGGCTG
CGCGGAGGACACTCAGTGCGGCGCTGCTTCAGCTCGAGGCTCTCCCTCGCTGCGTTTTGGCTCCTCTTATTGCACTCTGGGGGCCCCACCAGGGCTCCTGACAGAACCGATGGAAGGAGA
ACGTGGCCTGCAGTTTGCAGTCCCAACCCCCCACACCGCTTTGATACCCAATCAACTTTCAAGGTAGCGCGCGACCGGTAATGTCGACTTTGACTTGACGGCGGTCGGACCGTTTTGCTG
CGGACAGTGAAAGTCAAGCCGAAAGGCTCTGTGCTAGGTCGCAGTACACGGCATGTGCAATCCGTCGGCGGTGACGTCAACAGATCACGTTCGCTCGCGCACAGAGTACCACACGGGTGT
CGGGGCTTGGAACTGCAAAGTGCAGTCCGCATTCTCCCTCCATCCGTTCTGACACCTTGGTGTGGGATTGTCGTTCTTGGCCGGGCTGCATGCTTGCCTCGTCCTTGTGGGGCCTCCACC
TCGTGCTGCTCGTTCCATTCCCGCAGGGCAACATTGCCGTGGCCGCCCCTCAGTCGGCTGCTCCCCTCACCACCGGCAATGGCGCGGCCGCCGCCAACGGCGCTGCGCCGGGGGCGGAGG
TGGCGGCTGGGACGGAGGGGGATGCCAGCACGGAGGCGAGCACTGCCGTGACGAGTGCGCCGTCGGAGCACGCGGACCTGTACGCCGACACGGACGCGGTGGCGTCGCTGAGCAAAGAGG
ACGTGGAGCAGCTGCTGCGCAGCACGGGCCAGGACGCCACGCTGCTGGTGCTCTACGCGCCCTGGTGCCGCTTCTGCCAG
AGGTACGCCACTGTCCGAGGGACACAGCGGCTGGGAAGAG
GAAGGATCACAGCGTGCATTTGTCTGCAGTGGCGTGCTCAAGGGGTCGTTTGCTGTGCAGCCTTCTGAGCACTTGTCTTGTTCCAAGGACAAGTGAACGGCAGCTCAGCAGGATGACAGA
GCAGCCTCGGCATGGGCCAGGAGTCACCTTCGAGGACGGCGGGCCCAGCCCAATCCGTGACAGCCACGCGCAGCGGTGTGCCGACTTGCTCGTGTGCGAGGGCTCTGACGGGCGTGCTGT
GCTGCGCTGGTGCAGGCCATGGAGGAGAGCTACGTCCAGCTGGGCGAGCAGCTGCGGGGCACCAACGTGCGGGGGTGAGCGCCGCGGCCCCGCTCTGAGGGCCTTCTGCTGCAGCACCGC
GGACAGCCGGCGGCCCTCAGCTCGTGCCTGCTGCCTCTGCGATTGTGCTTCTCCGATGGCCGCTCACTGTCCCGCCTGCTGTGTGCTGTCCTGGCAGGTTGCCTCCTTCCGGGCCGATGG
GCCCGAGCGCGCCTTTGCGCAGAAGGAGTTTGGCCTCAAGAGCTTCCCCACCATCGTGCTCTTCCCGCGGCGAGCGCAAGGCAGCCGTAGCCGCGCCTTTGTTACCTACCCCTCGGAACG
GCGGGATCCGGCCAGCCTCCTCGCCTTTGTGAGTGCCATTGCGGGGCCAGTGGGAGAAACCTGGAGCGGGCCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCTGAGCACCCTTGCCCCTCAACTGGGGAGTGCGTCGTGGGCGGCGACCACTGGTCATCGTCCACACGGGGCCAGTTCAAGGGAGGCGTGTGTTGCAGGGACTCGTCTGGCCCTA
CACGGAGCACCAG
AGGCCCCCACCGCTGCTGCTGCGGTCTCTGCCTTCTGGGGGCACCAGCTGCGGCGGCTGCCTGGCGCGGCTATCCGCAGCCAGCGGACAGCATGCTCAAGGATCAGA
GCGGTCTCAG
TGGTGGAGGCTCCCCCGTCCGCAGGGGAGGTGGTGGACTACGCTGCTCTGGCCAAGGATCTGGCGGCGTCGTCCCCGCTGGAGATCATGGACACTGCGCTGGACCTGTTT
GGCAAAAACATTGGCATTGCCTTCAG
TGGGGCTGAGGATGTGGCCCTCATTGAGTACGCGCGGCTCACGGGACGGCCCTTTCGGGTGTTCAGCCTGGATACCGGCCGCTTGAACGCAGAG
ACGTACCGCTACTTTGCTCAG
GTGGAGGCGCACTACGGCATCCGCATCGAGTACTGCTTCCCGGAGGCCAAGGAGGTGGAGGACCTGGTGCGCACCAAGGGCATGTTCAGCTTCTACGAA
GACGGCCACCAGGAGTGCTGCGCCGTCCGCAAG
GTGCGGCCGCTGCGTAAGCAGCTGCGGACGCTGGACGCGTGGATCACGGGGCAGCGCAAGGACCAGAGCCCCGGGACGCGAGCCGCT
GTGCCGGTGGTGCAGGTGGACCCCGCGTTTGAGGGCCTCTCTGGGGGGCCCGGCAGCCTGGTCAAGTTCAACCCGCTGGCCAACGTCAAGGGCACCGATGTGTGGGGCTTCCTGCGCCTG
CTCAATGTGCCCGTCAACGAGCTGCACTCCAAG
GGCTTTGTGTCCATTGGGTGTGAGCCGTGCACGCGGTCGGTGCTCCCTGGGCAGCATGAGCGGGAGGGCCGCTGGTGGTGGGAGGAT
GCCACCATGAAGGAGTGCGGCCTGCACAAA
GGCAACATTGCCGTGGCCGCCCCTCAGTCGGCTGCTCCCCTCACCACCGGCAATGGCGCGGCCGCCGCCAACGGCGCTGCGCCGGGGGCG
GAGGTGGCGGCTGGGACGGAGGGGGATGCCAGCACGGAGGCGAGCACTGCCGTGACGAGTGCGCCGTCGGAGCACGCGGACCTGTACGCCGACACGGACGCGGTGGCGTCGCTGAGCAAA
GAGGACGTGGAGCAGCTGCTGCGCAGCACGGGCCAGGACGCCACGCTGCTGGTGCTCTACGCGCCCTGGTGCCGCTTCTGCCAG
GCCATGGAGGAGAGCTACGTCCAGCTGGGCGAGCAG
CTGCGGGGCACCAACGTGCGG
GTTGCCTCCTTCCGGGCCGATGGGCCCGAGCGCGCCTTTGCGCAGAAGGAGTTTGGCCTCAAGAGCTTCCCCACCATCGTGCTCTTCCCGCGGCGAGCG
CAAGGCAGCCGTAGCCGCGCCTTTGTTACCTACCCCTCGGAACGGCGGGATCCGGCCAGCCTCCTCGCCTTTGTGAGTGCCATTGCGGGGCCAGTGGGAGAAACCTGGAGCGGGCCTTAG

Retrieve as FASTA