Entry information : KflTrx51 (Kfl_000210420/NTRC)
Entry ID 14187
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-09 (Christophe Dunand)
Peroxidase information: KflTrx51 (Kfl_000210420/NTRC)
Name (synonym) KflTrx51 (Kfl_000210420/NTRC)
Class Other Thioredoxin    [Orthogroup: Trx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Klebsormidiophyceae Klebsormidiaceae Klebsormidium
Organism Klebsormidium flaccidum    [TaxId: 3175 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value KflTrx51
start..stop
S start..stop
HaTrx09 491 7e-174 58..382 55..381
PpaTrx04 364 2e-121 61..371 121..427
PpaTrx03 363 1e-120 62..395 128..457
ThasTrx03-2 344 6e-114 61..401 76..412
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 266089..267055 967 N° 2 267939..268043 105 N° 3 268806..269113 308  
join(266089..267055,267939..268043,268806..269113)


exon

Literature and cross-references KflTrx51 (Kfl_000210420/NTRC)
Protein sequence: KflTrx51 (Kfl_000210420/NTRC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   459
PWM (Da):   %s   49949.55  
PI (pH):   %s   6.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLTGAPYLSRALFQRITATLRQASALSTIKQQPHTRIISQSFTARFFTMGLRKEKTKLSTKLAIIGSGPAAHTAAVYAARAQLEPVLFEGWLANGIAAGGQLTTTTDVENFPGFPEGIHGSELTDKFRAQSERFGTQIFSETVNRVDFSKRPFTLWTDEKEVTAETVIVATGAIAKRLEFKGSGEVGGFWNKGISACAVCDGAAPIFRNVPLVVIGGGDSAMEEAIFLTKYGSKVYIIHRRDEFRASKIMQKRALEHPKIEVLWNTVVNEAYGNEKGRLGGLKVQNVVTGAVTDLPVNGLFFAIGHEPATKFLDGQLAMDEDDYIKVTPGTTETSVEGVFAAGDVQDKKWRQAITAAGTGCMAALQVEHFLELHGIQEGKSDPVQSEQVRNDTSKLADQHGERNELLPDHRPEKQENFEDDHSHLVLPPRSDEPMADGESKPMADVAESKPLKQLVASM

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGACTGGTGCCCCCTATCTGAGCAGGGCACTTTTCCAGCGAATTACCGCTACTCTAAGACAAGCCTCCGCTCTCAGCACGATTAAACAGCAGCCGCACACTCGAATCATTTCCCAA
TCCTTCACAGCAAGGTTCTTCACGATGGGGCTGAGAAAGGAGAAAACAAAGTTAAGCACGAAACTAGCAATCATTGGATCGGGCCCTGCGGCACACACTGCCGCAGTATATGCGGCGCGC
GCGCAACTCGAGCCTGTTCTCTTTGAGGGGTGGCTGGCGAATGGGATTGCTGCGGGCGGCCAATTGACCACCACAACCGACGTTGAGAACTTCCCTGGCTTTCCTGAAGGCATCCATGGC
TCTGAGCTGACTGACAAATTCCGAGCGCAGAGCGAGCGGTTCGGCACCCAGATCTTCTCTGAGACGGTGAATAGAGTGGACTTCTCGAAGCGGCCGTTCACGCTGTGGACGGATGAGAAG
GAGGTGACGGCAGAGACGGTGATTGTGGCCACTGGGGCGATTGCGAAAAGGCTCGAATTCAAGGGCTCGGGGGAGGTTGGCGGTTTCTGGAACAAGGGCATCTCGGCGTGCGCGGTGTGC
GACGGGGCCGCTCCAATCTTTCGAAATGTGCCGTTGGTCGTGATCGGGGGCGGTGACTCTGCCATGGAGGAGGCGATCTTCCTGACGAAGTATGGGTCCAAGGTTTACATCATCCACAGG
AGGGACGAGTTTAGGGCGAGCAAGATCATGCAGAAACGGGCGTTAGAGCACCCGAAGATTGAGGTACTCTGGAACACTGTTGTGAACGAGGCGTATGGGAACGAGAAGGGCAGGCTGGGT
GGACTGAAGGTGCAGAATGTTGTAACGGGGGCCGTGACAGATCTTCCGGTGAACGGTCTCTTCTTTGCGATAGGGCATGAGCCTGCGACCAAGTTCTTGGACGGACAGCTGGCGATGGAC
GAGGATG
GTGAGATCTGGACTTCCTTTCACAATTTGCCTTTCAGGATCACAAAGGTTTCTGCAACAGATCTGTTAATGTGCATAAGGTCACTGCCCCCGATCCTACGTGCTACTAAACTG
CCTGCTATCATGCACTGGCAAAGACTTGATTAAAAGCTTCTTGGAAATTCCAGACAAGCAGTTTGGCAATTTGCTTGGTCTTGGCTGGCTCCGACTGGTAATATTTCATTTCTGAGCTTC
CTTAAGACCCTCCCCCTCCGTGCAACTGTTTCTTCCCCCTCCCTAGCATAAGTGGTGGCAGATTGAGTCCTTGTCTTTGAACAAGTTTGTATGCAAACAAAGTTTACCAATCAGGGGAGG
AGACCTGTGAAGCAGGCTGCATGTCAAATGAAGGTGGTAGTTGAAATTAGGCTAGCTGCGGTGATCACATGCCTCGCTGACGCAATTACTCAACAATCATTTCAAAATGTGTGCTTGACA
TAGAGATTAGTCTGGGTTGCCCCCTCGTTGGAGTGCACGGTGCTTGATCTGGAGATTTGCTTAAGGATGTGAAAAGGTGGTACTATTCTGGCATTGGCCCCTTACTAGATGGATCGTCTG
CATGTTGATACTAATGAAGGAACAGCTCACATTGACTTGTTGCTCATGGGACTGGATTGAACGAAGAACGGAGTGAATCGTTCCCAAGAGGGTCTGAACCAGTATCGCAGGGACTGAATA
AGGCTCAGTGAATGACCGAGTAAAAGACTCCAGCTACCTGGATAAAGGCATTGTGCCAAGCTGAATGCGGCGATCGAATGTTGCATTAGTCACTCAAAGCAAGCTCCAAGACAACAAACG
CTTCATACGCCTCTTGTTCTAACATGGAGTGTGTGCCCTTGTTGGTGCAGATTACATCAAGGTCACGCCTGGGACAACAGAAACTAGTGTGGAGGGAGTGTTTGCCGCAGGCGACGTGCA
GGACAAGAAATGGCGACAGGCGATCACAGCCGCAG
GTAAGTCATCAGTGGGTTTGGCGTGCTTGAGGGTGCAGAAGTCGGAGTCAAGGGCCCCACAGGCTGAGCGGACGTGGTGGTTTGG
ACTGAAAAGAAGGGTGGACGGGGGGATCCCCATGGTGCTGCTCTTTCATTAAGAAAAATTGCGTTGCGCCTAGTTTCCTGGATTAGAATCGTTTACTCGTTTCTGATCAGTTGCTGATGG
TAGAGAAAATACTATCTGGCAATGTGTTTCACATCAAAACCGAGATTAGGATCTTTGTCAGACCCTTCGGCGCCAATTGCAGCCGCACCTTCTTTTGTTTTTGGTCGCATTAATGGCTGT
GCATGTCCCACATATTGAAGGGCTTTTGATTTTCATGGAACAGTGTGCGTTTGTAGCCCCTTCTCACACTACGCGAGGGGCCATGAAATGTTATGTTGCTTCCAACGATAACCTCTGGCT
TTTCTATCTGTGAAGGTTTGCAAGAGACTAGGCCCTTGTAAAAATATTGTGTTTGGGCGCCTGTTTCAGGAAGGCAGTCCGCATAGTCGGTGTCACCCAGCTAGAACCAGCGACTCAAAG
TTTGGTTACAAAACGGTCCAGGTTTTGCACTCGCCGCATTGAATGTAGCAACGTCTGTGCTGCGTGGCTACTTAAGGTCATCAAGATACTCCATGCAAAGAACCGCGCGAGGAAGTTTGA
GCCCTTGAACGCCGGTTGGAACAAGCCACCGATGTTTTGGAACCCAAGTTCATAATCAACTTCTACTCCTCGTGCAGGGACGGGCTGCATGGCCGCGCTCCAAGTGGAGCACTTTCTGGA
GTTGCACGGAATCCAGGAGGGCAAGTCGGACCCGGTCCAAAGCGAGCAGGTCCGCAACGACACGTCCAAACTCGCGGACCAGCACGGGGAGCGCAACGAGCTTCTGCCCGACCACCGGCC
AGAGAAGCAAGAGAACTTCGAAGATGACCATTCACACCTCGTATTGCCCCCACGCAGCGATGAGCCGATGGCGGACGGGGAAAGCAAGCCGATGGCGGATGTGGCTGAGAGCAAGCCGTT
GAAGCAGCTTGTTGCTAGCATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGACTGGTGCCCCCTATCTGAGCAGGGCACTTTTCCAGCGAATTACCGCTACTCTAAGACAAGCCTCCGCTCTCAGCACGATTAAACAGCAGCCGCACACTCGAATCATTTCCCAA
TCCTTCACAGCAAGGTTCTTCACGATGGGGCTGAGAAAGGAGAAAACAAAGTTAAGCACGAAACTAGCAATCATTGGATCGGGCCCTGCGGCACACACTGCCGCAGTATATGCGGCGCGC
GCGCAACTCGAGCCTGTTCTCTTTGAGGGGTGGCTGGCGAATGGGATTGCTGCGGGCGGCCAATTGACCACCACAACCGACGTTGAGAACTTCCCTGGCTTTCCTGAAGGCATCCATGGC
TCTGAGCTGACTGACAAATTCCGAGCGCAGAGCGAGCGGTTCGGCACCCAGATCTTCTCTGAGACGGTGAATAGAGTGGACTTCTCGAAGCGGCCGTTCACGCTGTGGACGGATGAGAAG
GAGGTGACGGCAGAGACGGTGATTGTGGCCACTGGGGCGATTGCGAAAAGGCTCGAATTCAAGGGCTCGGGGGAGGTTGGCGGTTTCTGGAACAAGGGCATCTCGGCGTGCGCGGTGTGC
GACGGGGCCGCTCCAATCTTTCGAAATGTGCCGTTGGTCGTGATCGGGGGCGGTGACTCTGCCATGGAGGAGGCGATCTTCCTGACGAAGTATGGGTCCAAGGTTTACATCATCCACAGG
AGGGACGAGTTTAGGGCGAGCAAGATCATGCAGAAACGGGCGTTAGAGCACCCGAAGATTGAGGTACTCTGGAACACTGTTGTGAACGAGGCGTATGGGAACGAGAAGGGCAGGCTGGGT
GGACTGAAGGTGCAGAATGTTGTAACGGGGGCCGTGACAGATCTTCCGGTGAACGGTCTCTTCTTTGCGATAGGGCATGAGCCTGCGACCAAGTTCTTGGACGGACAGCTGGCGATGGAC
GAGGATG
ATTACATCAAGGTCACGCCTGGGACAACAGAAACTAGTGTGGAGGGAGTGTTTGCCGCAGGCGACGTGCAGGACAAGAAATGGCGACAGGCGATCACAGCCGCAGGGACGGGC
TGCATGGCCGCGCTCCAAGTGGAGCACTTTCTGGAGTTGCACGGAATCCAGGAGGGCAAGTCGGACCCGGTCCAAAGCGAGCAGGTCCGCAACGACACGTCCAAACTCGCGGACCAGCAC
GGGGAGCGCAACGAGCTTCTGCCCGACCACCGGCCAGAGAAGCAAGAGAACTTCGAAGATGACCATTCACACCTCGTATTGCCCCCACGCAGCGATGAGCCGATGGCGGACGGGGAAAGC
AAGCCGATGGCGGATGTGGCTGAGAGCAAGCCGTTGAAGCAGCTTGTTGCTAGCATGTAA

Retrieve as FASTA