Entry information : CbraTrx05 (g19638/CHBRA237g00150/WCGVC)
Entry ID 14196
Creation 2016-10-27 (Christophe Dunand)
Last sequence changes 2016-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-11-04 (Christophe Dunand)
Peroxidase information: CbraTrx05 (g19638/CHBRA237g00150/WCGVC)
Name (synonym) CbraTrx05 (g19638/CHBRA237g00150/WCGVC)
Class Other Thioredoxin    [Orthogroup: Trx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Charophyceae Characeae Chara
Organism Chara braunii    [TaxId: 69332 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CbraTrx05
start..stop
S start..stop
PpaTrx02 146 1e-46 31..135 31..137
ThasTrx05 123 7e-38 29..135 10..118
KflTrx02 118 3e-35 32..134 31..133
HaTrx05 114 3e-34 18..135 3..122
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 635029..635046 18 N° 2 635732..636121 390  
join(635029..635046,635732..636121)


exon

Literature and cross-references CbraTrx05 (g19638/CHBRA237g00150/WCGVC)
Protein sequence: CbraTrx05 (g19638/CHBRA237g00150/WCGVC)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   136
PWM (Da):   %s   15153.43  
PI (pH):   %s   8.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPATFEKIAATSKASTMSMKTKQWPGMKSKHGNLIEVGTDEELEHVLSTAGKRPVVVNYGAPWCQACQGMLPAFYKCSNDFPAPMFVIVDVDKCSKNSENVRYTPTFRFFREGQAVDEFHGAGPQRLRDRVWLQS*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGCCACCTTTGAGGTAAGTCCAGCAGCTTCCTCTCTACTGAATACTGATTGGATAAGGTGTGCCAACCTTCTTCTGAGAGAATCCTGTGCTCAGAGACCGTGACAGGAGATCTTT
TGATGAATAGACAGGTTGCTAGACAGATAGGTAGGTAACTAGCTCAGTATCTACCAAGGTAGGGTAGGTAGCAAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGA
GAGAGAGAGAGAGAGAGAGAGAGAGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATCTAGATGTGTATAAGAGACAGGGGTAGGCTAGCAATCTTTGATTGTATTGAGCGACAGAGAGCGAACGACAGAAAGACAG
ATAGGGAGGGGGAGGGGGGAAACGGGCTGGGGGACAGGGGTCAACAGGCTGAGGAAGAGACTTTCTGTTACAAAAAATGGCAGCGCACATGTCTTCCGCGAAGAAGATTGCGGCGACAAG
CAAAGCTTCTACAATGTCTATGAAAACAAAGCAGTGGCCAGGGATGAAGAGTAAACATGGTAATTTGATAGAAGTAGGCACCGACGAGGAGCTTGAGCACGTGCTATCGACAGCTGGCAA
GCGGCCAGTGGTTGTGAACTATGGCGCGCCATGGTGCCAGGCATGTCAGGGCATGCTTCCCGCCTTCTACAAGTGCAGCAATGACTTCCCAGCACCAATGTTTGTCATTGTGGACGTTGA
CAAGTGTAGCAAGAATTCAGAAAATGTTCGATACACACCGACCTTCCGCTTTTTCCGCGAAGGCCAAGCGGTGGATGAGTTCCATGGTGCTGGACCTCAGAGGTTACGGGATCGAGTCTG
GCTCCAGTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGCCACCTTTGAGAAGATTGCGGCGACAAGCAAAGCTTCTACAATGTCTATGAAAACAAAGCAGTGGCCAGGGATGAAGAGTAAACATGGTAATTTGATAGAAGTAGGCACCGAC
GAGGAGCTTGAGCACGTGCTATCGACAGCTGGCAAGCGGCCAGTGGTTGTGAACTATGGCGCGCCATGGTGCCAGGCATGTCAGGGCATGCTTCCCGCCTTCTACAAGTGCAGCAATGAC
TTCCCAGCACCAATGTTTGTCATTGTGGACGTTGACAAGTGTAGCAAGAATTCAGAAAATGTTCGATACACACCGACCTTCCGCTTTTTCCGCGAAGGCCAAGCGGTGGATGAGTTCCAT
GGTGCTGGACCTCAGAGGTTACGGGATCGAGTCTGGCTCCAGTCTTGA

Retrieve as FASTA